SecReT6
Protein ID: 113866672
SecReT6 ID143
T6SS typei3
Gene symbolh16_A0645
Locus tagH16_A0645
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]685318..686364 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ0KDX8
KEGG IDreh:H16_A0645
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.60E-18, Aligned region: 66..125
Disulph_isomer [PF06491], Evalue: 0.0031, Aligned region: 266..322
Protein Sequence: 348 a.a.     [Download]
>gi|113866672|ref|YP_725161.1| hypothetical protein H16_A0645 [Ralstonia eutropha H16]
MNAKAKAVPVPRPDFPFPELLEPVAPDRPCGDDLEYDPEFVVLLAKAAPKPDAQYGNFVSEPEAINWADL
ERDCRRLLLRTRDIRILALLLRCRTRLGQASGLRDGLAAMARLLAKWPDAIHPQLCVDGETDPAMRANAL
AALTDPEGLMRDVRELTITGNAALRLQIRDVERSLGVPRPADALAPESVRQQMQDLRQQNSPALTALDEA
AGQAAAIDGWAKANLRQDSPDLSPLLKLLGMMTSTVATAPAPPVAASTAAPVASPSCGDAAGGLSPAATA
VHSGACKPRDRDAALATIRTARQWFEFHEPSSPVALLLRQAERLTGKRFDEVFQAIPADLVERWAQDT
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|113866031|ref|NC_008313.1|:c686364-685318 Ralstonia eutropha H16 chromosome 1, complete genome
ATGAATGCCAAAGCCAAGGCCGTACCGGTGCCAAGACCCGACTTTCCCTTCCCGGAACTGCTGGAACCTG
TCGCACCCGACAGGCCATGCGGTGACGACCTGGAGTACGACCCTGAGTTCGTCGTGCTGCTGGCCAAGGC
GGCGCCGAAGCCCGACGCGCAGTACGGCAACTTCGTCAGCGAGCCCGAAGCCATCAACTGGGCGGATCTG
GAGCGCGACTGCCGGCGCCTGCTGCTGCGCACGCGCGACATCCGCATCCTGGCGCTGCTGCTGCGCTGCC
GTACCCGGCTAGGCCAGGCAAGCGGTCTGCGCGACGGACTCGCGGCCATGGCGCGGCTGCTGGCAAAATG
GCCCGATGCCATCCATCCGCAGTTATGCGTCGATGGCGAAACCGATCCCGCGATGCGCGCCAATGCGCTC
GCCGCGCTGACCGACCCGGAGGGGCTGATGCGGGACGTGCGGGAGTTGACGATCACAGGCAACGCGGCGC
TCCGGCTGCAGATCCGGGATGTCGAGCGCTCGCTCGGCGTGCCGCGGCCCGCGGACGCCCTGGCGCCGGA
ATCGGTGCGGCAGCAAATGCAGGATCTGCGCCAGCAGAACAGCCCCGCCCTCACGGCACTCGACGAGGCC
GCAGGCCAGGCAGCGGCCATTGACGGTTGGGCAAAAGCCAACCTCCGGCAGGACAGCCCCGACTTGAGCC
CTCTGCTCAAGCTGCTTGGCATGATGACGAGCACTGTCGCGACCGCCCCGGCACCGCCGGTCGCTGCATC
CACCGCCGCGCCAGTCGCTTCTCCTTCATGCGGCGATGCTGCCGGCGGTCTTTCCCCTGCCGCAACCGCC
GTGCACTCAGGCGCCTGCAAACCGCGGGATCGCGATGCCGCCCTGGCCACCATCCGCACCGCGCGTCAAT
GGTTCGAGTTCCACGAACCCAGCAGCCCGGTGGCACTGCTGCTCAGGCAAGCCGAGCGGCTGACCGGCAA
GCGCTTCGATGAAGTGTTCCAGGCGATCCCTGCGGATCTGGTGGAGCGCTGGGCGCAGGACACATAG
 Primer design