SecReT6
Protein ID: 113866673
SecReT6 ID143
T6SS typei3
Gene symbolh16_A0646
Locus tagH16_A0646
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]686367..687407 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ0KDX7
KEGG IDreh:H16_A0646
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.50E-99, Aligned region: 25..326
Protein Sequence: 346 a.a.     [Download]
>gi|113866673|ref|YP_725162.1| hypothetical protein H16_A0646 [Ralstonia eutropha H16]
MFKGNDDNVPPSPAATAAPGNYAGQAPWKLSFLGLLRHLSARHPDLPPIGQASRPRDEPFRAGQQAALTF
APREIAQVQPLAGRLKVQLFGLGMLGPNGALPIHLTEVVRERSEAHRDNTTADFLDLFHHRAFTQFYRAW
ASAQATAGLDRRDGEVFSRYVGWLAGNEADEIAHSTLPPHARLAASAHQVREARDPDGIAATLSHFFGVP
VRLEEYVLHWIAVDPAERSRLGHPGAPGVMGQGAMLGEMVPDRQHKFRLVIGPLGLQQYLNFTPNGRDLP
TLIEWVRAFVGFEFVWEAELQVIPDSAPPAILGSQERLGWSTWLGEPDRSRAITGMVFEPEHYATH
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|113866031|ref|NC_008313.1|:c687407-686367 Ralstonia eutropha H16 chromosome 1, complete genome
ATGTTCAAAGGCAACGACGACAATGTGCCGCCCTCGCCGGCGGCGACGGCCGCGCCCGGAAACTATGCCG
GCCAGGCGCCGTGGAAGCTGAGCTTCCTGGGGCTCCTGCGGCATCTGTCCGCCCGGCACCCTGACTTGCC
CCCGATCGGGCAGGCAAGCCGGCCACGCGACGAGCCTTTCCGGGCTGGCCAGCAGGCCGCGCTCACCTTC
GCGCCCCGGGAGATCGCGCAGGTGCAGCCGCTGGCCGGCCGGCTCAAGGTGCAATTGTTTGGCTTGGGCA
TGCTGGGGCCGAACGGGGCGCTGCCGATTCACCTGACGGAAGTTGTACGCGAGCGTAGCGAAGCACACCG
GGACAACACCACCGCCGACTTCCTGGATCTTTTCCACCATCGCGCCTTCACGCAGTTCTACCGCGCGTGG
GCAAGCGCCCAAGCCACCGCGGGCCTCGATCGGCGCGACGGCGAGGTGTTCTCCCGCTATGTCGGCTGGC
TGGCGGGCAATGAAGCCGACGAAATCGCGCACAGCACCCTGCCGCCGCACGCCCGGCTCGCTGCGAGTGC
GCACCAGGTGCGCGAAGCGCGCGATCCCGACGGCATCGCGGCCACGCTTTCTCACTTCTTTGGTGTGCCC
GTCAGGCTTGAAGAGTATGTATTGCACTGGATCGCCGTCGATCCGGCCGAGCGCAGCCGCCTGGGACACC
CGGGCGCCCCAGGCGTCATGGGGCAAGGCGCCATGCTTGGCGAAATGGTGCCGGACCGCCAACACAAGTT
CCGCCTGGTGATCGGCCCGCTCGGGTTGCAGCAATACTTGAACTTCACGCCGAACGGCAGGGATCTTCCG
ACGCTCATCGAATGGGTGCGCGCCTTCGTCGGCTTCGAGTTCGTCTGGGAAGCCGAGCTGCAGGTGATCC
CGGACTCGGCGCCGCCTGCCATCCTGGGCTCGCAGGAACGCCTGGGCTGGTCCACATGGCTGGGCGAACC
GGATCGAAGCCGCGCCATCACCGGCATGGTGTTCGAGCCCGAACACTATGCAACACACTGA
 Primer design