SecReT6
Protein ID: 113866674
SecReT6 ID143
T6SS typei3
Gene symbolh16_A0647
Locus tagH16_A0647
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]687410..689320 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ0KDX6
KEGG IDreh:H16_A0647
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-211, Aligned region: 15..634
Protein Sequence: 636 a.a.     [Download]
>gi|113866674|ref|YP_725163.1| hypothetical protein H16_A0647 [Ralstonia eutropha H16]
MSNRSTPADTMDPQLLDYYNRELVYMRELAGEFAKQHPKVAKRLGMQGIEVADPYVERLIEAFCFLSART
EIKLDAEFPRFTQRLLEVIYPNYVAPTPSIAVAQFRPSQNEGDFAHGVEVPRGTEVNAAAAPGEKTACQF
RTTQPLTLWPVEITEARLTGIPPDVRGPERYVPAHVTVQGALRLRLRCTRGATFDQLPGLDHLPVYLRGD
DLIASQLFELLHSAGVATLIGHPGAMSERPCAVAQDAVSYVGMGPGEGALPLQWNSFHGHNLLHEYFACP
QRFYFFGLNKLAQGLSRIRGKEAEIVVLLSKPPRDLTSKVDREQFALFCTPVVNLFPKRTDRIEVTPGRA
EFHLVADRQHPLDYEIHTVRQLCAQRSEHSAGIDFQPLFTTLNSDEGNHGRYFSLRRERRLISEQARKYG
TRTAYVGTELFVSLVDQNEAPYPDALRYLSVESLVTNRDLPNLVPRNGRHDLTPAASIPVDGIGLIRAPS
APRPPYADGEMAWRLIRLLGFNYLSLTDLEHRSGGQGLRDMLRLFVANDDLAHQGQIQSLIGANVKPVMR
RLPGNGPLIYGRGIQCQLTVDEGGFSGISPYLFGVVLEHFLARHVSVNVFTQTELHSMQRGLVHRWPVRM
GGRSAV
 
Nucleotide Sequence: 1911 bp     [Download]
>gi|113866031|ref|NC_008313.1|:c689320-687410 Ralstonia eutropha H16 chromosome 1, complete genome
GTGTCCAATCGATCCACGCCAGCTGACACCATGGATCCGCAACTGCTCGATTACTACAATCGCGAGCTCG
TCTATATGCGCGAGCTGGCCGGGGAATTCGCCAAACAGCACCCGAAGGTCGCGAAACGGCTGGGCATGCA
GGGCATCGAGGTGGCCGACCCCTACGTCGAGCGCCTGATCGAGGCGTTCTGCTTCCTGTCAGCGCGTACC
GAGATCAAGCTGGACGCAGAGTTCCCACGCTTCACCCAGCGGCTGCTGGAGGTGATCTACCCCAACTATG
TGGCGCCGACGCCATCGATTGCGGTCGCGCAGTTCCGACCCAGCCAGAACGAGGGCGATTTTGCGCATGG
CGTGGAGGTTCCGCGCGGCACGGAGGTCAACGCGGCGGCGGCGCCTGGAGAGAAGACGGCCTGCCAGTTC
AGGACCACGCAGCCGTTGACACTGTGGCCGGTTGAGATCACCGAAGCGCGGCTCACTGGCATTCCGCCCG
ATGTCAGGGGGCCGGAGCGCTATGTGCCCGCCCATGTGACAGTACAGGGTGCACTGCGGTTGCGCCTGCG
CTGTACGCGAGGCGCGACCTTCGACCAGCTGCCCGGCCTGGACCACCTGCCGGTCTATCTGCGCGGCGAT
GACCTGATCGCCTCACAACTGTTCGAACTGTTGCACAGCGCCGGTGTGGCGACGCTGATCGGACACCCCG
GGGCCATGAGCGAGCGCCCCTGCGCAGTGGCGCAGGATGCTGTCAGTTACGTGGGAATGGGACCGGGCGA
AGGCGCGCTGCCTTTGCAGTGGAACAGCTTCCACGGGCACAACCTGTTGCATGAGTACTTCGCTTGCCCA
CAGCGCTTCTATTTCTTCGGCCTCAACAAGCTCGCTCAGGGCCTGAGCCGGATCCGCGGCAAGGAAGCCG
AGATCGTCGTGCTGCTGTCAAAGCCGCCCCGGGATCTGACCAGCAAGGTCGACCGCGAACAGTTCGCGCT
GTTTTGCACACCGGTGGTCAATCTGTTTCCAAAGCGCACCGATCGCATCGAGGTCACGCCGGGCCGCGCC
GAGTTTCACCTGGTCGCCGACCGGCAGCATCCGCTTGACTACGAAATCCACACCGTCAGGCAGCTCTGCG
CACAAAGGTCCGAGCACAGCGCAGGCATCGACTTCCAGCCGCTCTTTACCACCCTGAATAGTGATGAAGG
CAACCACGGCCGCTACTTTTCCCTGCGGCGCGAGCGTCGGCTGATCTCTGAGCAGGCTCGCAAGTACGGC
ACACGCACGGCATACGTCGGCACCGAGCTGTTCGTGTCGCTGGTGGACCAGAACGAAGCTCCCTACCCGG
ACGCCTTGCGCTACCTGTCAGTGGAATCGCTGGTTACAAATCGCGATCTGCCCAATCTTGTACCGCGCAA
TGGCCGGCACGACCTGACCCCGGCAGCTTCCATCCCCGTGGACGGGATCGGCCTGATCCGCGCGCCGTCG
GCACCACGGCCGCCCTATGCGGACGGAGAAATGGCCTGGCGCCTGATACGGCTGCTGGGCTTCAACTACT
TGTCGCTGACCGACCTGGAGCATCGCTCAGGCGGCCAGGGCCTGCGTGACATGCTGCGGCTTTTCGTGGC
GAACGACGACCTCGCGCACCAGGGGCAAATCCAGAGCCTGATCGGCGCGAACGTGAAGCCAGTCATGCGC
CGGCTGCCAGGCAACGGGCCCTTGATCTACGGCCGCGGCATCCAGTGCCAGCTCACGGTGGACGAAGGCG
GCTTCTCCGGCATCAGCCCATATCTGTTCGGCGTGGTGCTGGAGCATTTCCTGGCGCGCCACGTCTCGGT
CAATGTCTTCACGCAAACCGAACTGCACTCCATGCAACGCGGCCTGGTGCATCGTTGGCCCGTGCGCATG
GGCGGCCGCAGCGCCGTGTAG
 Primer design