SecReT6
Protein ID: 113866675
SecReT6 ID143
T6SS typei3
Gene symbolh16_A0648
Locus tagH16_A0648
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]689295..689816 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ0KDX5
KEGG IDreh:H16_A0648
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-18, Aligned region: 39..150
Protein Sequence: 173 a.a.     [Download]
>gi|113866675|ref|YP_725164.1| hypothetical protein H16_A0648 [Ralstonia eutropha H16]
MAEHRPPRRPNSQLLPTLLDRLRDDAPQRQTESADEYTVTRAQMREIIQRDLTYLLNTTNREDEIDRKRY
PAAAASTINYGVSPVAGSYLAEHKWSDIVTIVRRAILDFEPRLIPGSLEVKPLLKEDAPQRYNTLVFEIK
GLIHMNPYPMAFTAQSSLDLETSRMSVQSIHAS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|113866031|ref|NC_008313.1|:c689816-689295 Ralstonia eutropha H16 chromosome 1, complete genome
ATGGCTGAACACCGCCCGCCGCGCCGCCCGAATTCGCAACTGCTGCCGACGTTGCTGGACCGGCTGCGCG
ACGACGCGCCCCAGCGCCAGACGGAAAGCGCGGACGAATACACCGTCACGCGTGCCCAGATGCGCGAGAT
CATCCAACGCGACCTCACCTATCTGCTCAACACCACCAATCGCGAGGATGAAATCGATCGCAAGCGCTAT
CCCGCTGCTGCCGCATCGACCATCAACTACGGCGTGTCCCCGGTCGCCGGCAGTTATCTGGCCGAACACA
AGTGGAGCGATATCGTCACCATCGTCAGGCGTGCGATCCTGGACTTCGAACCCCGGCTCATCCCCGGCTC
GCTGGAAGTGAAGCCGCTACTGAAAGAAGATGCGCCACAACGCTATAACACCCTGGTGTTCGAGATCAAA
GGCCTGATCCATATGAACCCGTATCCGATGGCGTTCACTGCCCAAAGCTCGCTCGACCTGGAAACCAGCC
GGATGAGTGTCCAATCGATCCACGCCAGCTGA
 Primer design