SecReT6
Protein ID: 113866676
SecReT6 ID143
T6SS typei3
Gene symbolimpE
Locus tagH16_A0649
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]689809..690645 [-]
ProductImpE family protein
NoteTagJ
UniProt IDQ0KDX4
KEGG IDreh:H16_A0649
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.30E-49, Aligned region: 152..272
Protein Sequence: 278 a.a.     [Download]
>gi|113866676|ref|YP_725165.1| ImpE family protein [Ralstonia eutropha H16]
MTLEAHTPRQAPGTGLSSILRRSGSVKGALAQTEAQVREEPGSFAFRWQLFQWLCVVGDWSRALKQLQVA
TQLAPGFAQTAHVYRDLIRAEVFRGEVFAGQRTPGSLLPAPAWVAKLHTALAENKAGECSAADASRHLAL
SQVPASAGAHDGVRFAWITDTDTRLGPTCEIVTAGRYAWLPFAQMRKIELGKASGLLDLLWRPATVTLAD
GVVSRGFLPVRYPGSEQGSDGIRLARETSWSEAGETGVIGFGQKTWMTDTGDVAMLDVTTLTLDAEHG
 
Nucleotide Sequence: 837 bp     [Download]
>gi|113866031|ref|NC_008313.1|:c690645-689809 Ralstonia eutropha H16 chromosome 1, complete genome
ATGACGCTTGAAGCGCACACCCCTCGTCAGGCACCCGGCACGGGGCTGTCATCAATCCTTCGCCGAAGCG
GCTCGGTCAAAGGCGCGCTGGCCCAGACGGAGGCGCAGGTCCGCGAGGAACCTGGCTCTTTCGCTTTCCG
TTGGCAGCTATTCCAGTGGCTCTGCGTGGTCGGTGACTGGTCCAGGGCCCTCAAGCAATTGCAGGTCGCC
ACGCAGCTTGCGCCCGGCTTCGCGCAAACCGCGCATGTGTACCGCGACCTGATCCGTGCGGAGGTGTTTC
GTGGCGAGGTATTCGCCGGCCAGCGCACCCCCGGCTCGCTGCTGCCGGCCCCGGCGTGGGTGGCAAAGCT
CCACACGGCTCTGGCGGAAAACAAGGCCGGCGAATGCTCAGCCGCGGACGCCAGCCGGCACCTGGCCCTG
TCGCAGGTGCCAGCCTCAGCCGGCGCGCACGACGGCGTGCGCTTTGCCTGGATTACCGACACAGACACAC
GGCTGGGACCGACCTGCGAGATCGTGACCGCGGGGCGCTACGCCTGGCTGCCCTTTGCGCAGATGCGCAA
GATCGAGTTGGGCAAGGCGTCCGGGTTGCTGGATCTGTTATGGCGCCCGGCCACGGTGACACTCGCCGAC
GGCGTGGTCAGCCGTGGCTTCCTGCCGGTGCGCTACCCAGGCTCCGAACAAGGCAGCGACGGGATTCGGC
TGGCTCGCGAAACCAGCTGGAGTGAAGCGGGTGAGACAGGTGTCATCGGTTTCGGCCAGAAGACCTGGAT
GACAGACACGGGAGATGTCGCCATGCTGGATGTGACAACGCTCACCCTGGACGCGGAGCATGGCTGA
 Primer design