SecReT6
Protein ID: 113866678
SecReT6 ID143
T6SS typei3
Gene symbolclpC1
Locus tagH16_A0651
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]691692..694406 [+]
ProductATP-dependent protease Clp, ATPase subunit
NoteTssH
UniProt IDQ0KDX2
KEGG IDreh:H16_A0651
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-37, Aligned region: 231..311
AAA_2 [PF07724], Evalue: 1.00E-37, Aligned region: 615..781
AAA [PF00004], Evalue: 5.40E-21, Aligned region: 233..365
AAA [PF00004], Evalue: 5.40E-21, Aligned region: 621..705
ClpB_D2-small [PF10431], Evalue: 9.40E-14, Aligned region: 788..859
AAA_5 [PF07728], Evalue: 8.40E-13, Aligned region: 233..311
AAA_5 [PF07728], Evalue: 8.40E-13, Aligned region: 620..725
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 32..77
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 210..255
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 273..312
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 497..497
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 612..656
AAA_16 [PF13191], Evalue: 1.80E-10, Aligned region: 685..712
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 233..313
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 619..644
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 682..701
Sigma54_activat [PF00158], Evalue: 3.70E-06, Aligned region: 228..258
Sigma54_activat [PF00158], Evalue: 3.70E-06, Aligned region: 619..720
AAA_19 [PF13245], Evalue: 8.80E-06, Aligned region: 231..257
AAA_19 [PF13245], Evalue: 8.80E-06, Aligned region: 380..410
AAA_19 [PF13245], Evalue: 8.80E-06, Aligned region: 502..536
AAA_19 [PF13245], Evalue: 8.80E-06, Aligned region: 617..642
NACHT [PF05729], Evalue: 9.90E-06, Aligned region: 233..260
NACHT [PF05729], Evalue: 9.90E-06, Aligned region: 292..340
NACHT [PF05729], Evalue: 9.90E-06, Aligned region: 620..648
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 233..257
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 617..646
Zeta_toxin [PF06414], Evalue: 1.70E-05, Aligned region: 232..255
Zeta_toxin [PF06414], Evalue: 1.70E-05, Aligned region: 610..660
AAA_29 [PF13555], Evalue: 3.40E-05, Aligned region: 223..251
AAA_29 [PF13555], Evalue: 3.40E-05, Aligned region: 618..645
AAA_14 [PF13173], Evalue: 3.60E-05, Aligned region: 233..313
AAA_14 [PF13173], Evalue: 3.60E-05, Aligned region: 619..702
AAA_17 [PF13207], Evalue: 3.70E-05, Aligned region: 233..275
AAA_17 [PF13207], Evalue: 3.70E-05, Aligned region: 620..656
Clp_N [PF02861], Evalue: 5.20E-05, Aligned region: 27..74
Clp_N [PF02861], Evalue: 5.20E-05, Aligned region: 112..124
IstB_IS21 [PF01695], Evalue: 0.00012, Aligned region: 221..253
IstB_IS21 [PF01695], Evalue: 0.00012, Aligned region: 620..640
AAA_18 [PF13238], Evalue: 0.00033, Aligned region: 233..256
AAA_18 [PF13238], Evalue: 0.00033, Aligned region: 621..649
Arch_ATPase [PF01637], Evalue: 0.003, Aligned region: 212..249
Arch_ATPase [PF01637], Evalue: 0.003, Aligned region: 286..316
Arch_ATPase [PF01637], Evalue: 0.003, Aligned region: 619..632
AAA_23 [PF13476], Evalue: 0.0039, Aligned region: 233..264
AAA_23 [PF13476], Evalue: 0.0039, Aligned region: 618..645
AAA_30 [PF13604], Evalue: 0.004, Aligned region: 176..202
AAA_30 [PF13604], Evalue: 0.004, Aligned region: 232..255
AAA_30 [PF13604], Evalue: 0.004, Aligned region: 618..649
T2SE [PF00437], Evalue: 0.005, Aligned region: 216..254
T2SE [PF00437], Evalue: 0.005, Aligned region: 615..689
TIP49 [PF06068], Evalue: 0.0052, Aligned region: 233..255
TIP49 [PF06068], Evalue: 0.0052, Aligned region: 288..313
TIP49 [PF06068], Evalue: 0.0052, Aligned region: 619..655
TIP49 [PF06068], Evalue: 0.0052, Aligned region: 773..811
RNA_helicase [PF00910], Evalue: 0.0053, Aligned region: 234..254
RNA_helicase [PF00910], Evalue: 0.0053, Aligned region: 621..642
UPF0079 [PF02367], Evalue: 0.0071, Aligned region: 233..254
UPF0079 [PF02367], Evalue: 0.0071, Aligned region: 614..646
Protein Sequence: 904 a.a.     [Download]
>gi|113866678|ref|YP_725167.1| ATP-dependent protease Clp, ATPase subunit [Ralstonia eutropha H16]
MDISRQALFGRLNLTLFKAIESATAFCKLRGNPYVELVHWLHQLLQAPDGDLQRMLRHAGADLSVLEADL
TRALAALPAGATSISDFSFQLESAIERAWVYATLAFSDDHVRGAYLLAALLKTPELRRTVLGISSQFAKV
RPDDLVEMAPALIAQSPESREAAYDGSGLAPATPGEASGATAPASAGKPALGRYCRDLTEEARAGRLDPV
IGREHEIRTMTDILLRRRQNNPLLTGEAGVGKTAVIEGLAQAIAAGEVPPSLKDIRLLSLDVGALLAGAS
MKGEFEARLKGVLEEAAKSPTPVILFVDEVHTLVGAGGQAGTGDAANLLKPALARGTLRTIGATTWSEYK
RHIEKDPALTRRFQVLQVMEPDEARAVAMVRGLVRTFEAHHQVLIRDEGVRAAVRLSHRFIPSRQLPDKA
ISLLDTACARVALSLHAPPAEVEHLRHELAAADAECALLAREAGFGRPDAARIALARARREQFEADLALA
SARWDRVRGLATDLVARRYALVQSASDESTVAAPARRTLDELEGHLHAAQADAPLVYTEVDERVVAAIVA
DWTGIPVGRMVADEVATVMQLPQTLGERVIGQGHALTQLGERVTTARAQLTDPNKPVGVFLLAGPSGVGK
TETALALADALYGGEQNLITINLSEFQEPHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEVEK
AHADIHEVFYQVFDKGYMEDGEGRHIDFRNTILLLTSNAGSDLLANLCEDPALMPEPAALRDALMPELRK
VFPAAFLGRLVVVPYLPLAAENLGRIVRLHLDRVAVRMQHQHGIVLTYDDPVVEFIVARCPVGETGARQL
IGFIEQVIQPQLARLWLLALSEKRELAVIAIRVADSAPAGLAYHTEYRVGHDAVVPECPEAGSA
 
Nucleotide Sequence: 2715 bp     [Download]
>gi|113866031|ref|NC_008313.1|:691692-694406 Ralstonia eutropha H16 chromosome 1, complete genome
ATGGATATTTCGCGTCAGGCTTTATTTGGCCGACTCAATCTCACGCTATTCAAGGCGATCGAAAGCGCGA
CGGCCTTTTGCAAGCTCCGCGGCAACCCGTACGTGGAGCTTGTGCATTGGCTCCACCAACTGCTGCAAGC
CCCGGATGGCGACCTGCAGCGGATGCTGCGCCATGCCGGCGCCGACCTGTCCGTGCTTGAAGCCGACCTG
ACCCGCGCGCTGGCCGCGTTGCCTGCCGGCGCCACCTCGATCAGTGACTTTTCGTTCCAGCTTGAGTCGG
CGATCGAGCGAGCGTGGGTCTATGCGACGCTTGCTTTTTCCGATGACCACGTGCGCGGCGCTTATCTGCT
CGCTGCGCTGCTCAAGACGCCGGAGTTGCGCCGTACGGTGCTGGGCATCTCAAGCCAGTTCGCGAAGGTG
CGGCCCGATGACCTGGTGGAAATGGCACCGGCGCTCATCGCGCAATCGCCTGAGAGCCGTGAAGCGGCTT
ATGACGGCAGTGGCCTGGCGCCGGCCACACCGGGTGAAGCCAGTGGCGCGACGGCACCTGCCAGTGCCGG
CAAGCCCGCCCTGGGCAGGTACTGCCGCGACCTGACCGAGGAGGCACGCGCGGGCCGGCTGGATCCGGTG
ATCGGTCGCGAGCATGAGATCCGCACCATGACGGACATCCTGCTGCGCCGCCGTCAGAACAATCCGCTCC
TGACCGGAGAGGCGGGTGTCGGCAAGACCGCCGTCATCGAGGGGCTGGCACAGGCCATTGCCGCGGGTGA
GGTGCCGCCCAGCCTGAAGGACATCAGGCTGCTGAGCCTCGACGTGGGTGCGCTGCTAGCGGGCGCCAGC
ATGAAAGGCGAGTTCGAAGCGCGGTTGAAGGGCGTGCTTGAGGAAGCTGCCAAATCCCCGACGCCCGTGA
TCCTGTTCGTCGATGAGGTCCACACACTGGTTGGCGCCGGTGGCCAGGCCGGCACCGGCGATGCCGCGAA
CCTGCTCAAGCCGGCGCTGGCGCGTGGGACACTGCGCACGATCGGCGCCACCACCTGGAGCGAATACAAG
CGCCACATCGAGAAGGACCCGGCGCTCACCCGCCGCTTCCAGGTCCTGCAGGTCATGGAACCGGACGAAG
CCAGGGCGGTTGCCATGGTGCGGGGTCTGGTCCGGACGTTCGAGGCGCATCACCAGGTACTGATCCGCGA
CGAGGGGGTGCGCGCCGCCGTCAGGCTATCGCATCGCTTTATCCCGTCGCGGCAGTTGCCCGACAAGGCG
ATCAGCCTGCTCGACACCGCTTGTGCGCGCGTAGCCCTGTCATTGCATGCGCCCCCGGCAGAAGTCGAAC
ATCTGCGCCACGAACTCGCCGCGGCCGACGCCGAGTGCGCACTATTGGCCCGGGAAGCCGGCTTTGGCCG
GCCGGACGCTGCGCGGATTGCGCTCGCACGGGCTCGGCGCGAGCAGTTCGAAGCCGACCTGGCTTTGGCC
TCGGCGCGCTGGGACCGGGTGCGCGGTCTGGCGACCGACCTGGTCGCCCGCCGATACGCACTGGTGCAGT
CCGCGTCGGATGAATCGACTGTGGCCGCGCCGGCGCGACGAACCCTGGATGAGCTCGAGGGCCATCTTCA
TGCCGCGCAAGCGGATGCGCCGCTTGTGTACACGGAAGTGGATGAACGCGTGGTCGCCGCAATCGTCGCC
GACTGGACCGGTATCCCGGTTGGGCGCATGGTCGCGGACGAGGTGGCAACCGTGATGCAGCTGCCGCAGA
CACTTGGCGAACGCGTGATCGGGCAAGGCCATGCGCTAACCCAGCTCGGGGAGCGCGTCACGACCGCCCG
TGCACAACTGACTGACCCCAACAAGCCGGTCGGAGTCTTCCTGCTGGCAGGCCCGTCGGGCGTTGGCAAG
ACCGAGACTGCGCTGGCGTTGGCCGACGCCCTGTACGGCGGTGAGCAAAACCTCATCACCATCAACCTCT
CGGAATTCCAGGAGCCGCATACCGTCTCGACGCTCAAGGGCGCGCCGCCGGGTTATGTCGGCTACGGCGA
AGGGGGCGTACTGACCGAAGCGGTGCGCCGCCGGCCCTACAGCGTGGTGTTGCTCGACGAGGTCGAGAAG
GCCCATGCCGATATCCACGAAGTCTTCTACCAGGTCTTCGACAAGGGCTACATGGAGGATGGCGAGGGGC
GCCATATCGACTTCAGGAACACCATCCTGCTGCTCACCAGCAATGCCGGCTCCGATCTGCTGGCGAATCT
CTGTGAAGACCCGGCGCTGATGCCGGAGCCCGCTGCACTGCGCGACGCGCTGATGCCCGAGCTGCGCAAG
GTGTTCCCGGCGGCGTTCCTCGGGCGGCTGGTAGTCGTGCCATATCTGCCGCTGGCGGCTGAAAACCTGG
GCCGCATCGTGCGCCTGCATCTCGATCGCGTGGCGGTGCGCATGCAGCATCAGCACGGCATTGTGCTGAC
TTACGACGACCCGGTGGTCGAGTTCATCGTGGCGCGCTGTCCGGTCGGCGAGACCGGCGCCCGGCAGCTG
ATCGGCTTCATTGAGCAGGTCATCCAGCCGCAACTGGCGCGCCTGTGGCTGTTGGCCCTGTCCGAGAAGC
GCGAGCTCGCCGTGATCGCGATCCGCGTCGCCGACAGCGCGCCTGCCGGGCTCGCCTACCACACCGAATA
CCGCGTTGGCCACGATGCCGTTGTGCCGGAGTGTCCCGAGGCCGGCTCGGCTTGA
 Primer design