SecReT6
Protein ID: 113866679
SecReT6 ID143
T6SS typei3
Gene symbolh16_A0652
Locus tagH16_A0652
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]694446..694979 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ0KDX1
KEGG IDreh:H16_A0652
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.80E-61, Aligned region: 11..164
Protein Sequence: 177 a.a.     [Download]
>gi|113866679|ref|YP_725168.1| hypothetical protein H16_A0652 [Ralstonia eutropha H16]
MSVVNSSQKFIARNRAPRVQIEYDVEVYGSEKRIELPFVMGVLADLSGRPAEPLPAVADRKFLEIDIDNF
DERMKAMKPRVAFAVPNTLSGDGQLMVDMTFESIEDFSPAAVAGKVDALRQLLEARTQLANLQTYMDGKS
GAESLINQLLQDPALLQSLAKAPKPRAGDDEPQSPQS
 
Nucleotide Sequence: 534 bp     [Download]
>gi|113866031|ref|NC_008313.1|:694446-694979 Ralstonia eutropha H16 chromosome 1, complete genome
ATGTCTGTTGTGAACAGTTCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTACAGATCGAGTACG
ACGTCGAAGTCTATGGCTCGGAGAAGCGTATCGAGCTGCCCTTCGTGATGGGCGTGCTGGCCGACCTGTC
GGGCAGGCCGGCCGAGCCGCTGCCGGCGGTTGCCGATCGCAAGTTTCTTGAGATCGATATCGACAACTTC
GACGAGCGCATGAAGGCCATGAAGCCGCGCGTGGCGTTTGCGGTGCCCAACACGCTGTCCGGCGACGGCC
AGCTCATGGTCGACATGACATTCGAGAGCATCGAGGATTTCTCGCCCGCGGCGGTAGCCGGCAAGGTTGA
TGCGCTCAGGCAATTGCTCGAAGCCCGCACCCAGCTCGCCAACCTGCAGACCTACATGGATGGCAAGTCG
GGCGCCGAATCGCTGATCAACCAGTTGCTGCAGGATCCCGCGCTGCTGCAGTCGCTTGCCAAGGCGCCCA
AGCCCAGGGCCGGCGACGACGAACCTCAGTCGCCGCAGTCCTGA
 Primer design