SecReT6
Protein ID: 113866680
SecReT6 ID143
T6SS typei3
Gene symbolh16_A0653
Locus tagH16_A0653
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]695029..696522 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ0KDX0
KEGG IDreh:H16_A0653
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-193, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|113866680|ref|YP_725169.1| hypothetical protein H16_A0653 [Ralstonia eutropha H16]
MATAQPAQHQALASADHSDFAALISREFSPKTEQAREAVDLAVKTLAEQALASSFTMSDDAYKSIEAIIG
AIDKKLSEQINLILHHEDFQKLESAWRGLHHLVSNTETDDKLRIRVMDVSKEELRRTLRRYKGIGWDQSP
FFKRIYEEEYGQLGGEPYGCLVADYYFDHTPPDVELLGSLAKISAAAHAPFIAGASPSVLQMDSWQELAN
PRDLSKIFQNLEYAPWNSLRNSEDARYVGLAMPRFLSRLPYGIKTNPVDEFDFEEDTDGADHRKYVWSNA
AYAMAVNINRSFKLYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDIKCPTEIAISDRREAELSKNGFIS
LVHRKNTDYAAFIGAQSMQKPAEYYDADATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVEELEGNPGYYSAKFFLRPHFQLEGLTVPLRLVARL
PSVKDAA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|113866031|ref|NC_008313.1|:695029-696522 Ralstonia eutropha H16 chromosome 1, complete genome
ATGGCCACCGCCCAACCAGCACAACACCAAGCGCTCGCGAGCGCTGACCATTCCGACTTCGCCGCGCTGA
TCAGCCGCGAATTCTCGCCCAAGACCGAACAGGCCCGCGAGGCCGTCGACCTCGCCGTCAAGACCCTGGC
CGAGCAGGCGCTCGCCAGCTCGTTCACCATGAGCGATGATGCCTACAAGAGCATCGAAGCCATCATCGGC
GCCATCGACAAGAAGCTCTCCGAGCAGATCAACCTGATCCTGCACCATGAGGACTTCCAGAAGCTGGAGT
CCGCCTGGCGCGGCCTGCACCACCTGGTCTCAAACACCGAAACCGACGACAAGCTGCGCATCCGCGTGAT
GGATGTGTCCAAGGAAGAGCTGCGCCGGACCCTGCGCCGCTACAAGGGCATCGGCTGGGACCAAAGCCCG
TTCTTCAAGCGCATCTATGAAGAAGAGTACGGCCAGCTTGGTGGTGAACCCTACGGCTGCCTGGTAGCCG
ACTACTACTTCGATCACACACCGCCCGACGTCGAACTCCTTGGCTCGCTTGCCAAGATCTCGGCAGCGGC
TCACGCCCCGTTCATTGCAGGCGCCTCGCCGTCGGTGCTGCAGATGGATTCGTGGCAGGAACTCGCCAAT
CCGCGCGATCTGTCCAAGATATTCCAGAACCTGGAATACGCGCCGTGGAACAGCCTGCGCAACTCGGAAG
ATGCCCGCTATGTCGGCCTCGCCATGCCGCGTTTCCTGTCGCGCCTTCCCTACGGCATCAAGACCAATCC
GGTCGATGAATTTGACTTCGAGGAAGACACCGACGGTGCGGATCACCGCAAGTACGTGTGGAGCAATGCT
GCCTACGCCATGGCGGTCAACATCAACCGTTCGTTCAAGCTCTATGGCTGGTGCACGCTGATCCGCGGCG
TCGAAAGCGGCGGCGTGGTCGAGAACCTGCCGTGCCACACCTTCCCGACCGACGATGGCGGCATTGACAT
AAAGTGCCCGACCGAAATCGCCATCTCGGACCGCCGTGAAGCCGAACTGTCGAAGAACGGCTTTATCTCG
CTGGTGCACCGCAAGAACACCGACTACGCAGCTTTTATCGGTGCCCAGTCGATGCAGAAGCCAGCCGAGT
ACTACGACGCTGATGCGACCGCCAATGCCAACCTGTCGGCACGCCTGCCGTACCTGTTCGCCTGCTCGCG
CTTTGCCCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCGCCTTCAAGGAACGCGAGGACATGCAG
CGCTGGCTCAACGAATGGATCATGAATTACGTTGATGCCGACCCGGCCAACTCGTCGCAGGAGACCAAGG
CACGCCGACCGCTGGCTGCAGCCGAGGTGGTCGTCGAGGAACTGGAAGGCAACCCCGGCTACTACAGCGC
CAAGTTCTTCCTGCGTCCGCACTTCCAGCTCGAGGGCCTGACCGTTCCGCTGCGGCTTGTGGCGCGCCTG
CCGTCGGTCAAGGACGCCGCCTGA
 Primer design