SecReT6
Protein ID: 113866683
SecReT6 ID143
T6SS typei3
Gene symbolh16_A0656
Locus tagH16_A0656
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]698568..701162 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ0KDW7
KEGG IDreh:H16_A0656
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.70E-75, Aligned region: 38..356
DUF2345 [PF10106], Evalue: 1.80E-42, Aligned region: 635..790
T6SS_Vgr [PF13296], Evalue: 4.20E-34, Aligned region: 500..608
T6SS_Vgr [PF13296], Evalue: 4.20E-34, Aligned region: 724..757
Phage_base_V [PF04717], Evalue: 3.10E-18, Aligned region: 395..488
Protein Sequence: 864 a.a.     [Download]
>gi|113866683|ref|YP_725172.1| hypothetical protein H16_A0656 [Ralstonia eutropha H16]
MNRLAAFASCSRTVSVSSAAIPDLLGQPQLEFVRLSGHEGLSELFTYKVDLRAVSPAAEQYLAEADPDAM
IGREMTVTIELDGMGTGLLGGVGAGHREITGVISDIEHVGGVAENRLYRFTLRPWLWLATQTSDFKPFQK
KTVIEILDEVLADYPFSVEKRLDTSVYPKLAWEVQHGETDAHFIQRLTEEYGITYFFEHDGGHHRLILAA
ESGAYRAFPSEAYRTLPLYPRGFKIDQEHLVRFDPVNRLRTGKVTLNDYDPRKPRANLTTDNSQPRNTSF
ADFERYEHPGDYVDPAVGEMRARIRMEERRSRGRRARGVGALRGVVAGCTYLVSNHGNPAMNREYLVIGA
TLELEDVGGESGSGQQFSCRVAFEAHPTDEVFRPPRTVGKPYVAGVQRAVVTGPKNQEIWCNDHGNVIIQ
FEWDRYGKYDENSSPWIRVVNGWSGDQFGAMHIPRIGQEVIVAFINGDPDCPVIVGRAPNQLNLPPWALP
GQHALSGIRSKELFGGRHNHLLMDDTKDQIQAQLSSDHQASQLNLGYLTGVPDHAGRKDRRGEGFDLRTD
GQGAIRGGKGLFVTAEGQVGAMGGHLSRDEFIRCMEAALEAAKALGDYGHAHEGLAADTDPQAELTRAVR
EWDAGANNHKDVPGEGGQPLIGAYAPAGMALATPKILTTYAGKHIDTVSRLNQQMTAGQQFVVNAGQGIG
FFAHSGELRGIAHQGNLLLQAQKSNIEANARQNVVVTATDGNIVLNAGKSLSLMTADGAGIRIGGGKVDI
YGPGGILLHTSDFDIVGPSSLNGPLPQFSQGDAGRKFLLKAGELERPVPNAPYQIVKADGSVVEGVTNAA
GETAQSASDLIEAVSVKIFAPKLY
 
Nucleotide Sequence: 2595 bp     [Download]
>gi|113866031|ref|NC_008313.1|:698568-701162 Ralstonia eutropha H16 chromosome 1, complete genome
ATGAATCGGCTAGCTGCTTTTGCTTCGTGTTCTCGCACCGTTAGCGTTTCCAGCGCAGCCATTCCTGATT
TGCTGGGACAGCCCCAGCTGGAATTCGTGAGGCTCTCAGGTCATGAGGGATTGAGCGAACTCTTCACCTA
CAAGGTAGACCTGCGTGCGGTCTCGCCTGCCGCGGAACAGTATCTTGCGGAGGCAGATCCCGATGCGATG
ATCGGCCGCGAGATGACCGTCACGATCGAGCTCGATGGCATGGGCACAGGGCTGCTGGGTGGCGTGGGCG
CAGGGCACCGCGAGATCACCGGCGTCATCTCAGATATCGAGCATGTCGGCGGCGTTGCGGAGAATCGCTT
GTACCGGTTCACGCTGCGTCCCTGGCTGTGGCTCGCGACGCAGACGTCGGACTTCAAGCCCTTCCAGAAG
AAGACGGTGATTGAGATTCTTGACGAGGTGCTTGCGGACTACCCGTTCTCGGTGGAGAAGCGCCTCGATA
CATCGGTCTATCCGAAGCTTGCCTGGGAGGTGCAGCATGGCGAGACCGATGCGCATTTCATCCAGCGCCT
GACCGAAGAGTATGGCATTACATACTTCTTCGAGCATGACGGCGGACACCATCGGCTGATCCTGGCCGCC
GAATCGGGCGCGTACCGCGCGTTTCCCAGCGAGGCCTATCGCACGCTGCCACTCTATCCGCGTGGCTTCA
AGATCGACCAGGAACATCTGGTCCGCTTCGATCCGGTCAACCGGCTGCGCACGGGCAAGGTGACGTTGAA
CGACTACGATCCACGCAAGCCGCGCGCGAATCTGACCACCGACAACAGCCAGCCGCGCAATACCAGCTTC
GCCGACTTCGAGCGCTACGAGCACCCGGGCGACTATGTCGATCCGGCGGTGGGCGAGATGCGGGCGAGGA
TCCGCATGGAGGAGCGCCGCTCGCGTGGCCGGCGTGCGCGGGGCGTGGGTGCGCTGCGCGGAGTGGTGGC
GGGCTGCACCTACCTGGTGAGCAATCACGGCAACCCGGCGATGAACCGCGAGTATCTGGTGATCGGTGCG
ACGCTGGAGCTGGAGGATGTCGGCGGCGAATCCGGCAGCGGGCAACAGTTTTCGTGCCGCGTTGCGTTTG
AAGCGCACCCCACTGATGAAGTCTTTCGCCCGCCGCGCACGGTCGGCAAGCCATACGTGGCCGGCGTGCA
GCGGGCCGTGGTGACCGGCCCGAAGAACCAGGAGATCTGGTGCAACGATCACGGCAACGTGATCATTCAA
TTCGAATGGGATCGCTACGGGAAGTACGACGAGAACTCGTCACCGTGGATTCGGGTGGTCAACGGCTGGT
CGGGCGACCAGTTCGGCGCGATGCACATTCCGCGTATCGGGCAGGAGGTCATTGTGGCGTTCATCAACGG
CGATCCGGACTGTCCCGTGATTGTCGGGCGGGCGCCGAATCAGCTCAATCTGCCGCCGTGGGCGCTGCCG
GGGCAGCATGCCTTGTCGGGGATTCGCAGCAAGGAGTTGTTTGGCGGGCGCCACAATCACCTGCTGATGG
ACGATACGAAGGATCAGATCCAGGCGCAGCTGTCCTCGGATCACCAGGCATCGCAACTGAACCTGGGCTA
TCTGACCGGGGTGCCGGACCACGCCGGGCGCAAGGACCGGCGTGGTGAAGGCTTCGACCTGCGCACCGAT
GGGCAGGGTGCCATACGCGGTGGGAAGGGCTTGTTCGTTACCGCGGAAGGGCAGGTAGGCGCCATGGGCG
GGCACCTGTCGCGCGACGAGTTTATCCGCTGCATGGAGGCGGCGCTGGAGGCGGCGAAGGCGTTGGGGGA
CTATGGCCATGCCCATGAAGGGCTGGCTGCCGATACGGACCCGCAGGCCGAACTCACGCGGGCCGTCAGG
GAGTGGGACGCTGGCGCCAACAACCACAAGGACGTGCCTGGTGAGGGAGGTCAGCCGCTGATCGGTGCCT
ATGCGCCGGCGGGCATGGCACTGGCCACGCCCAAGATATTGACGACGTATGCCGGCAAGCATATCGACAC
CGTCTCACGGTTGAACCAGCAAATGACCGCAGGGCAGCAGTTCGTTGTCAATGCGGGGCAGGGAATCGGG
TTCTTCGCGCACAGCGGTGAGCTGCGCGGCATTGCGCATCAGGGCAATCTGCTTCTGCAGGCGCAGAAAT
CCAACATCGAAGCGAATGCCAGACAGAACGTAGTGGTGACCGCAACCGATGGCAACATCGTTCTGAACGC
GGGCAAGAGCCTGAGCTTGATGACAGCGGACGGTGCCGGCATCCGCATTGGCGGAGGCAAGGTGGATATC
TATGGTCCTGGCGGGATCCTGCTGCATACGTCGGATTTCGACATCGTAGGGCCGTCCAGCCTGAACGGAC
CGTTGCCGCAGTTTAGCCAGGGTGACGCGGGCCGAAAGTTCCTGCTGAAGGCAGGCGAGCTCGAGCGACC
GGTCCCCAATGCACCCTACCAGATTGTCAAGGCGGACGGCAGTGTGGTGGAAGGTGTAACCAATGCCGCT
GGCGAAACCGCGCAGTCGGCTTCGGATCTGATCGAGGCGGTGAGCGTAAAGATATTTGCGCCCAAGCTGT
ACTGA
 Primer design