SecReT6
Protein ID: 113866687
SecReT6 ID143
T6SS typei3
Gene symbolh16_A0660
Locus tagH16_A0660
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]707107..707613 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ0KDW3
KEGG IDreh:H16_A0660
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.00E-43, Aligned region: 15..162
Protein Sequence: 168 a.a.     [Download]
>gi|113866687|ref|YP_725176.1| hypothetical protein H16_A0660 [Ralstonia eutropha H16]
MARSVSLLGLFAASVLGSACSTAPAQREQMKLDLAVSAKDTVNPDDKGRPSPVLVRVYELKTDSAFENAD
YYSLEKSDKTLLTQDLLARDEFILRPGESRDIERKLNPDTQAIGILVGYRELGKATWRSVYKLPPAPDAA
WYRMAIPARKVKLQVSLDQQTITISKPD
 
Nucleotide Sequence: 507 bp     [Download]
>gi|113866031|ref|NC_008313.1|:707107-707613 Ralstonia eutropha H16 chromosome 1, complete genome
ATGGCGAGAAGCGTGTCGCTGCTTGGCCTATTCGCAGCATCGGTCCTCGGCTCGGCCTGCTCCACAGCAC
CGGCCCAGCGCGAGCAGATGAAGCTGGATCTGGCTGTATCCGCCAAAGATACCGTCAACCCTGACGACAA
GGGCAGGCCCTCTCCGGTCCTGGTTCGGGTCTACGAACTCAAGACCGACAGCGCGTTTGAGAATGCGGAC
TACTACTCGCTGGAGAAGTCGGACAAGACGCTGCTGACGCAGGATCTGCTGGCACGAGACGAGTTCATCC
TCCGGCCCGGCGAGTCGCGCGACATCGAGCGCAAGCTCAATCCGGACACGCAAGCCATCGGCATTCTGGT
CGGGTACAGGGAGCTTGGCAAAGCCACCTGGAGATCTGTCTACAAACTGCCACCGGCGCCGGACGCTGCG
TGGTACCGCATGGCAATTCCGGCACGCAAGGTCAAGCTGCAAGTCTCGTTGGACCAGCAGACCATCACAA
TTTCCAAACCTGATTGA
 Primer design