SecReT6
Protein ID: 113866688
SecReT6 ID143
T6SS typei3
Gene symbolh16_A0661
Locus tagH16_A0661
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]707618..708961 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ0KDW2
KEGG IDreh:H16_A0661
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.00E-151, Aligned region: 20..446
Protein Sequence: 447 a.a.     [Download]
>gi|113866688|ref|YP_725177.1| hypothetical protein H16_A0661 [Ralstonia eutropha H16]
MSWYNKVVWSEGLFLRPQLFQQQERYLEHYAHKRSAALSPFFWGFHHFSIDAEALSLGKLVVSSAAGIFQ
DGTPFDAPAHTAVPAPLALQAEHLNQIICLAVPIRTPNAEETNFDDATDSLARYRAFEQELLDANSIAQG
PKLVQLADLRLRLLPEKELSESWLGLPLTRVTEIRADGSARLDAALIPPVNVYTASALLQTWLTEIHGLL
HLRADAMAERLSAATMRGGDAAEVSEYLILQLLNRYEPILTHLLKAKAASPEVLYLHLAALSGELSTFVR
TQTRRPAEHAAYRHDAPHLCLKPLVDDLRFLLNVVLERAAQRIEITEQSHGIRTAVLDPGEIGRFATFVL
AVTAQVPADLLQQQFPAQTKVGPSARLAELVRSHLPGIPLQSLPVPPRQIPFNAGHVYFELSQQHPLWDQ
VAQYGGLALHVAGTFPELRMELWGVRQ
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|113866031|ref|NC_008313.1|:707618-708961 Ralstonia eutropha H16 chromosome 1, complete genome
ATGAGCTGGTACAACAAGGTCGTCTGGAGCGAGGGACTGTTCCTGCGCCCGCAACTCTTTCAGCAGCAGG
AGCGCTATCTGGAACACTACGCGCACAAGCGTAGCGCCGCGCTCAGCCCGTTCTTCTGGGGCTTTCACCA
TTTCTCGATCGATGCTGAAGCGCTCTCGCTGGGTAAGCTGGTGGTCTCCAGTGCCGCTGGAATCTTCCAG
GACGGTACGCCCTTTGACGCTCCGGCACATACGGCAGTGCCGGCGCCGCTTGCGCTTCAGGCCGAGCACC
TGAATCAGATCATCTGTCTGGCGGTGCCGATCCGCACGCCAAATGCGGAAGAAACGAATTTCGATGATGC
CACGGATTCCCTGGCGCGATACCGTGCCTTTGAGCAGGAATTGCTGGATGCGAATTCGATCGCACAGGGA
CCAAAACTGGTGCAGTTGGCAGACTTGCGTCTTCGGCTTTTGCCGGAGAAGGAACTCTCCGAGTCCTGGC
TTGGCCTGCCGTTGACAAGAGTGACGGAAATCCGCGCCGATGGCAGTGCCAGACTGGATGCAGCGCTGAT
TCCGCCGGTCAATGTCTACACGGCCAGTGCATTGCTTCAAACATGGCTTACCGAAATCCACGGCCTCCTG
CATCTCAGGGCCGATGCGATGGCCGAGCGCCTGTCTGCTGCCACTATGCGGGGCGGGGATGCTGCCGAAG
TATCGGAATACCTGATCCTCCAATTGCTGAACCGGTACGAGCCGATTCTGACCCACCTGCTGAAGGCCAA
GGCCGCGTCGCCAGAGGTGTTGTACCTGCACCTGGCGGCATTGTCGGGGGAACTGTCGACGTTCGTGCGC
ACCCAGACCCGTCGGCCGGCTGAGCATGCGGCTTATCGGCACGATGCTCCGCATCTTTGCCTGAAGCCAT
TGGTTGACGACCTGCGCTTCCTGCTCAATGTGGTGCTGGAACGCGCTGCGCAGCGGATTGAAATCACGGA
GCAGTCACATGGGATCCGAACGGCGGTGCTCGATCCGGGCGAGATCGGCCGTTTCGCGACCTTTGTGCTG
GCGGTGACCGCGCAGGTTCCGGCGGATCTGTTGCAGCAGCAGTTTCCGGCCCAGACCAAGGTGGGGCCGT
CTGCGCGGTTGGCGGAACTGGTTCGGTCCCATCTTCCTGGAATTCCGCTGCAGTCATTGCCGGTGCCGCC
ACGGCAGATCCCGTTCAATGCTGGCCATGTCTACTTTGAACTGTCCCAGCAGCACCCGCTCTGGGACCAG
GTGGCGCAGTACGGTGGGCTGGCGCTGCACGTAGCGGGGACCTTTCCTGAGTTGCGTATGGAACTGTGGG
GAGTGCGGCAATGA
 Primer design