SecReT6
Protein ID: 113866689
SecReT6 ID143
T6SS typei3
Gene symbolh16_A0662
Locus tagH16_A0662
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]708958..710235 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ0KDW1
KEGG IDreh:H16_A0662
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-64, Aligned region: 30..54
DUF2077 [PF09850], Evalue: 1.30E-64, Aligned region: 56..260
OmpA [PF00691], Evalue: 5.90E-17, Aligned region: 319..417
Protein Sequence: 425 a.a.     [Download]
>gi|113866689|ref|YP_725178.1| outer membrane protein [Ralstonia eutropha H16]
MSKPLVSSDPQLDSQAAQPAKAGDRASPRAAAEASSQNDARKSVEQRVEEISRKANPLLAAARPLLRALA
DMPTSLRQDQAAALKGILVGEAKDFQAVCERANIRREHVLAAQYCLCTALDEAANGMPWGRHTWANNSLL
IQLHGENDGGEKVFQLLGRLASSAAEHMDVIEVIYHILSLGFLGRYAGHADGDRQLDAIRQRLLHLISAA
RESVPRDLSPHWRGADAGRLSLLRTVPVWVTASVLALAVFGQFAWYKYQLLFRTHDLEQQILAIGKATPP
EPPKALRLAELLKDEIARGVISVQEDATRSAVTFRGDDMFGGGRAEVSDKVLPLLDKVAGEINKVSGKVT
VVGHSDNVPIKTAKYPSNQVLSEERAATVTEYLASKGVAKNRLEAIGKGDSEPLTDNKTPAARARNRRVE
IVVTP
 
Nucleotide Sequence: 1278 bp     [Download]
>gi|113866031|ref|NC_008313.1|:708958-710235 Ralstonia eutropha H16 chromosome 1, complete genome
ATGAGCAAGCCACTTGTGTCGAGTGATCCCCAATTGGACTCGCAAGCAGCACAGCCTGCCAAGGCAGGAG
ATCGCGCGAGCCCACGCGCCGCAGCGGAGGCGAGCAGCCAGAACGACGCGCGCAAGTCCGTTGAGCAGCG
GGTGGAAGAGATCAGCCGCAAGGCCAATCCCTTGCTTGCGGCAGCGCGGCCGCTGTTGCGCGCACTGGCC
GACATGCCGACATCGCTGCGACAGGATCAGGCGGCTGCACTGAAGGGAATTCTGGTGGGGGAAGCGAAAG
ATTTTCAGGCAGTCTGCGAGCGCGCCAATATTCGGCGCGAGCACGTTCTGGCTGCACAGTATTGTCTGTG
CACGGCGCTGGATGAGGCTGCCAATGGCATGCCATGGGGGCGCCATACCTGGGCGAACAACAGCTTGCTG
ATCCAGCTGCATGGCGAAAACGATGGCGGCGAGAAGGTGTTCCAGTTGTTGGGGCGGCTGGCGAGCTCCG
CCGCAGAGCACATGGACGTGATCGAGGTGATCTATCACATCTTGTCACTCGGCTTCCTTGGCCGCTATGC
TGGCCACGCCGATGGCGATCGCCAGCTCGACGCCATTCGGCAGCGGTTGTTGCACCTGATCAGCGCGGCA
CGCGAAAGCGTGCCGCGCGACCTGTCGCCACACTGGCGCGGCGCGGACGCCGGGCGCCTCAGCCTGCTTC
GCACAGTGCCGGTGTGGGTCACGGCGTCGGTGCTGGCACTGGCGGTCTTTGGCCAGTTCGCCTGGTACAA
GTACCAACTCTTGTTCCGCACCCACGATCTCGAACAGCAAATCCTCGCCATCGGCAAGGCAACACCGCCG
GAGCCGCCCAAGGCGCTGCGCCTCGCCGAGTTGCTCAAGGATGAGATTGCGCGTGGGGTTATCAGCGTAC
AGGAGGATGCGACCCGCAGTGCCGTCACGTTCCGCGGGGATGACATGTTCGGCGGTGGCCGCGCCGAGGT
CAGCGACAAGGTCCTGCCGTTGCTGGACAAGGTTGCCGGAGAAATCAACAAGGTATCCGGCAAGGTGACC
GTGGTCGGCCACAGCGACAACGTTCCCATCAAGACGGCGAAGTACCCGTCAAACCAGGTGCTGTCGGAAG
AGCGTGCTGCGACCGTGACAGAGTACCTGGCCAGCAAGGGCGTCGCAAAGAATCGGCTCGAAGCGATTGG
CAAGGGCGATTCGGAGCCGCTTACCGACAACAAGACGCCAGCCGCCCGGGCAAGGAATCGCCGGGTCGAA
ATCGTTGTAACGCCGTAA
 Primer design