SecReT6
Protein ID: 113866690
SecReT6 ID143
T6SS typei3
Gene symbolh16_A0663
Locus tagH16_A0663
StrainRalstonia eutropha H16
Repliconchromosome I [GenBank: NC_008313] [Browse all T6SS(s) in this replicon]
Location [Strand]710248..714069 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ0KDW0
KEGG IDreh:H16_A0663
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.50E-94, Aligned region: 577..897
ImcF-related_N [PF14331], Evalue: 4.80E-91, Aligned region: 255..530
DUF1215 [PF06744], Evalue: 2.40E-29, Aligned region: 1006..1130
Protein Sequence: 1273 a.a.     [Download]
>gi|113866690|ref|YP_725179.1| protein of unknown function, ImcF-related [Ralstonia eutropha H16]
MEFLKRIGAVLFSRQTLALIAVLMVAAAIWFIGPLLGFSSMHPLAGIGARVTLMVLLLATTLFWLLGWPV
STTGLAALCLLIWHAGPLLAIGASHPLEPSSVRILLIAAIVLVFVGYVLYLLWQRARTDKTFVESLLNFG
GKREEVVAKDEIARLNTAVQTALRQLKGMRSGSRVGRLFEGRRYLYELPWYMMVGVPGAGKTTALLNAGL
QFPIAGQMSAAARARDGTEQADWWFTNEAVLIDTAGRYTAQEAGSAIDPAEWKGFLGLLRKYRARAPING
ALVTISVEDLLWHSKEERVIEAARIRARLAELREELGIQFPVYVLVTKVDQLAGFTDYCQYLTSEGRAQP
LGFTFPVAGKRRRGQPAIDVVAQCREEMWALVERLEAGQVGRLYEEFDLARRRALYALSDEFASVTEPLV
AMLEQVFLDSRYDDTERNSMLRGVYFTSAAQTGEAIVADASTVIRRVRGNGKSGAQDAAVAEKSTGNRSY
FLQDVFKRIIVPEAHLVKPNLRWEFRFRLLRLFGHALVLVISLWLAGALYTSFGDNRSYLAVVQEKAKAL
AATVTAFYKKPQPDAMPEVLGAARDLPAYAGLDLVNPSADWRYGLYSVVPVLGAATLTHTRLQDNLLVPY
LVRRVEAVLSTAVSQRDAKQAYDTLRVYLMLHDKDKFNASDVRSWVRSDWATGNGADAFGGRVAVLEHLD
SLLDGSRPVLSPYAKNEALIRSARDFLDSDTSVERLYDRAKAAMMEEAPQDFTLVRAVGPQAGTVFTRAS
GEPLERGIPGLFTYAGYHDLFNVRLPEFVARAQAVDIWVMGRGTGPGAQKKTADNAVGRLTGNDPLTREI
RRLYLSEYARNWEKFLGDIRTVTGSNLAFDLEILRNFAAPDSPLARLGRAAVQETTLSRTLEPEEKSLAE
KALSALDKKADKASALSVRAEARQERELVDNRFAALREVVTGQADAAAPGARDTAGKPQLDTIAGIVNAY
YTSLVVANNALSTRNLPPPADAGEQLRMEAAKLPAPFKAVLTDLVVQGARDVNKGVGDILIAQMDAVIGE
SCRGAIDGKYPFTPTSMQDVDPEDFARVFAAGGVLDDFFQKVLAPHVDTTISPWRYKLTAPDVPPVAGPS
LVPFQRAREIREVFFRDPGAKKMAWKVDLKVVELDPEIVELNMDFDGQSQRYVHGPVIPLKVTWPGPRGG
QGAEITASPRIRPDTSTLAANGPWALMRVIAKGRLAGSASASHFMAEYDFDGRRAKLDINTGSLANPWTT
GLLQGFQCPGRSG
 
Nucleotide Sequence: 3822 bp     [Download]
>gi|113866031|ref|NC_008313.1|:710248-714069 Ralstonia eutropha H16 chromosome 1, complete genome
ATGGAATTTCTGAAACGTATCGGCGCTGTGCTGTTCTCCCGGCAGACGCTCGCGCTCATTGCCGTGCTCA
TGGTCGCGGCAGCTATCTGGTTCATCGGGCCGCTGCTCGGGTTCAGTAGCATGCATCCGCTGGCGGGCAT
CGGCGCGCGCGTCACGCTCATGGTGCTGTTGCTGGCAACGACGCTGTTCTGGTTGCTTGGCTGGCCGGTC
TCCACGACAGGCCTCGCCGCGCTGTGTCTGCTGATCTGGCATGCGGGGCCGTTGCTTGCGATTGGCGCCA
GCCATCCGCTGGAGCCGAGCTCAGTCCGCATTCTGCTGATCGCGGCGATTGTGCTCGTGTTCGTCGGCTA
TGTGTTGTACCTGCTTTGGCAGCGCGCACGCACGGACAAGACTTTTGTCGAGAGCCTGCTGAACTTTGGC
GGGAAGCGCGAGGAGGTTGTGGCCAAGGATGAAATCGCCAGGCTGAACACGGCGGTTCAGACTGCCCTGC
GACAACTCAAGGGCATGCGTAGCGGCAGCCGGGTCGGTCGCCTGTTCGAAGGCCGCCGCTACCTCTATGA
ACTGCCCTGGTACATGATGGTTGGCGTGCCGGGGGCCGGCAAGACGACGGCGTTGCTGAACGCCGGACTG
CAATTCCCTATCGCGGGTCAGATGAGTGCGGCGGCTCGCGCACGGGATGGCACCGAGCAGGCAGATTGGT
GGTTCACCAATGAGGCGGTTCTGATCGACACGGCAGGCCGCTATACGGCGCAGGAAGCGGGTTCGGCGAT
CGACCCGGCAGAATGGAAGGGATTCCTCGGCCTGCTGCGAAAATATCGCGCCCGCGCCCCGATCAACGGC
GCGCTGGTGACGATCAGCGTGGAGGACCTGCTTTGGCACTCCAAAGAGGAGCGGGTGATCGAAGCGGCCA
GGATTCGGGCGCGCCTGGCCGAACTGCGCGAGGAACTGGGCATCCAGTTTCCTGTCTACGTGCTGGTGAC
CAAGGTCGATCAGCTTGCCGGCTTCACGGACTATTGCCAGTACCTGACCAGCGAAGGCCGTGCCCAGCCT
TTGGGGTTCACCTTTCCGGTTGCGGGAAAGCGGCGGCGGGGACAGCCAGCAATCGATGTTGTTGCGCAGT
GCCGTGAGGAGATGTGGGCGCTGGTGGAGCGGCTGGAAGCCGGGCAGGTCGGACGGCTGTATGAGGAGTT
CGATCTGGCCCGACGCCGGGCGCTCTACGCGCTGAGCGACGAGTTCGCGAGCGTGACGGAGCCGCTTGTC
GCGATGCTGGAGCAGGTATTCCTTGACTCGCGCTATGACGACACCGAGCGGAATTCCATGTTGCGCGGCG
TGTATTTCACCAGTGCGGCGCAAACCGGGGAAGCGATCGTCGCGGATGCGAGCACCGTGATCCGGCGGGT
GCGTGGCAACGGGAAGTCTGGCGCCCAGGACGCCGCCGTCGCGGAAAAGTCAACCGGCAACCGCAGCTAC
TTCCTGCAGGACGTCTTCAAGCGCATCATCGTGCCCGAGGCGCACCTGGTGAAGCCGAACCTGCGCTGGG
AGTTCCGCTTCCGCCTGTTGCGCCTGTTTGGCCATGCGCTGGTGCTGGTCATTTCCCTGTGGCTAGCCGG
AGCGCTCTATACGAGCTTTGGCGACAATCGCAGCTATCTGGCGGTGGTGCAGGAGAAAGCCAAGGCGCTG
GCCGCCACGGTAACGGCGTTTTACAAGAAGCCGCAGCCTGATGCGATGCCGGAGGTGTTGGGAGCGGCCC
GCGACCTGCCTGCCTACGCCGGCCTGGATCTGGTCAATCCTTCTGCTGATTGGCGCTATGGCCTGTACAG
CGTGGTGCCGGTGCTGGGCGCCGCGACCTTGACCCATACCAGGTTGCAGGACAACCTGCTGGTGCCGTAC
CTGGTGCGCCGGGTCGAAGCGGTGCTGTCAACGGCGGTCAGTCAGCGCGACGCCAAGCAGGCCTACGACA
CGCTGCGGGTCTACCTGATGCTGCATGACAAGGACAAGTTCAACGCATCCGACGTGCGTAGCTGGGTGCG
CAGCGACTGGGCGACGGGCAACGGGGCGGATGCCTTTGGTGGCCGCGTGGCGGTGCTGGAGCATCTGGAC
AGCCTGCTCGATGGCAGCCGGCCGGTCTTGTCGCCCTACGCAAAGAACGAGGCACTGATCCGCTCGGCGC
GCGATTTCCTGGACAGCGATACCTCGGTCGAACGCCTGTATGACCGCGCCAAGGCGGCCATGATGGAAGA
GGCACCGCAGGATTTCACGCTGGTGCGCGCGGTCGGTCCCCAGGCCGGCACGGTCTTTACCCGGGCCAGC
GGCGAGCCGCTGGAGCGCGGTATTCCGGGGCTTTTTACCTATGCCGGCTACCACGACCTGTTCAATGTCC
GTTTGCCGGAGTTTGTCGCCAGGGCGCAGGCGGTCGACATTTGGGTGATGGGGCGTGGAACAGGGCCTGG
CGCTCAAAAAAAAACGGCTGACAATGCCGTCGGCCGGCTCACGGGCAATGATCCGCTCACGCGCGAGATC
CGGCGCCTTTACCTGAGCGAATATGCCCGGAACTGGGAGAAGTTTCTGGGTGACATCCGGACCGTGACGG
GAAGCAACCTGGCCTTTGACCTGGAGATCCTGCGCAACTTTGCCGCGCCGGATTCACCGCTTGCCCGGCT
GGGCAGGGCCGCGGTGCAAGAAACGACGCTCAGCCGCACGCTCGAGCCCGAGGAAAAGTCCCTTGCGGAG
AAGGCGTTGTCAGCGCTGGACAAGAAGGCCGACAAAGCCAGCGCACTGAGCGTGCGTGCCGAGGCCCGTC
AGGAACGCGAGCTGGTCGATAACCGCTTCGCCGCGCTGCGCGAAGTGGTTACCGGCCAGGCCGACGCGGC
GGCGCCAGGCGCGCGGGACACCGCCGGCAAGCCGCAACTGGATACGATTGCCGGCATCGTCAATGCTTAC
TACACCAGTCTGGTAGTGGCCAATAACGCGCTGAGCACCCGGAACCTGCCGCCGCCCGCGGATGCAGGCG
AGCAGTTGCGCATGGAGGCGGCGAAGCTGCCGGCGCCCTTCAAGGCGGTGCTGACCGACCTGGTCGTGCA
GGGCGCCAGGGACGTCAACAAGGGTGTTGGCGATATCCTGATTGCGCAGATGGACGCCGTCATCGGCGAG
AGCTGCCGCGGCGCCATCGACGGCAAGTATCCGTTCACGCCGACGTCGATGCAGGACGTGGACCCGGAAG
ACTTTGCACGCGTCTTCGCCGCGGGCGGAGTGTTGGACGACTTTTTCCAGAAGGTGTTGGCGCCGCACGT
GGATACCACCATCTCGCCTTGGCGCTACAAGCTGACCGCCCCCGACGTGCCGCCCGTGGCTGGCCCGAGT
CTGGTGCCGTTCCAGCGCGCCAGGGAAATCCGGGAAGTGTTCTTCCGGGATCCGGGAGCGAAGAAGATGG
CCTGGAAGGTCGACCTGAAGGTGGTGGAACTCGATCCCGAAATCGTCGAGCTGAACATGGACTTCGACGG
ACAGAGCCAGCGTTACGTGCACGGTCCGGTCATCCCGCTCAAGGTGACCTGGCCGGGACCGCGGGGCGGG
CAAGGGGCCGAGATCACTGCCAGCCCCCGGATTCGTCCGGATACCTCGACGCTGGCCGCCAACGGCCCGT
GGGCCCTGATGCGGGTGATTGCCAAGGGCAGGCTCGCCGGCTCCGCTAGCGCCAGCCACTTCATGGCCGA
ATATGACTTCGACGGCCGCAGGGCGAAGCTCGATATCAATACCGGCAGCCTCGCCAACCCCTGGACCACC
GGGCTGCTGCAGGGCTTCCAGTGTCCCGGGAGATCCGGGTGA
 Primer design