SecReT6
Protein ID: 114319221
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0057
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]61425..65042 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDQ0ACM3
KEGG IDaeh:Mlg_0057
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.10E-79, Aligned region: 526..841
ImcF-related_N [PF14331], Evalue: 3.50E-66, Aligned region: 124..141
ImcF-related_N [PF14331], Evalue: 3.50E-66, Aligned region: 218..477
DUF1215 [PF06744], Evalue: 5.20E-32, Aligned region: 936..1056
AAA_16 [PF13191], Evalue: 0.0023, Aligned region: 125..289
AAA_16 [PF13191], Evalue: 0.0023, Aligned region: 589..648
AAA_16 [PF13191], Evalue: 0.0023, Aligned region: 910..1009
Protein Sequence: 1205 a.a.     [Download]
>gi|114319221|ref|YP_740904.1| ImcF domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
MSDKARNRVAGRLRGTMGSVTGGRVSRYSGWVGALRRGWPWVVGLLGIALLAVVWIWGPAWQIGGARPLA
PWPNRLLVILCAVLVVLVIIGLRLRARLRDAEPPRDEAEIPDPVAQATAGQEQGLNHCLDQLRRQRGRHA
LQALPWYLVLGPEGSGKTSLVQRSGQRFSLTRSLHPQGGEASDSGLRCWASDRAVTLEPGAAWLLQGGWD
RDGADALSASLWQHLVGWLQRRRPRRPLDGVLLVLDLSRLTSAGARDDWGDALRERLQELTTTYQSRLPV
YVVFSQMDRLYGFDAFFRHAVGDARCEPWGFSFSAGSLADPDAWEEEFTGAYRRMLGRIERQLVAWLAAC
RDQGEREALFRFSRQLAGLEPLLSETLQRVLGSRRYAVEPLVRGVYFASLGQQGVPIDAFADAATARYRL
PDLVHRARRNGQQSLAWFSERLLQRVVFPEAGLAGDSLRFVRRRRWLRGAGLVFSLAGLSGLVIGWGHYY
QHNLVALQAVEARAEALADLRPAQEHLDDPSGQHLVPALDELREVAGVFDGPRGAWAGLADMGLYQGHRV
GDAMDQAYLDALRYRFLPALMLGIADEMNTLAPGSEEQLVRLRVLRMLADARGREPDRVRDYMADRWQAL
LPNRGRLQGRLLEHLDHALVHTDLAGRQAHDPRAAAALAPVAGSIRKAQQAFSRSPVDERVYTLLKRRGQ
DRAGGGVRLDRSVGSGWGTVFRADDDDPDGVTVSPLLTRDGFEQVFLGELDGATVLALNDLWVLGERDDP
QFSERDEQRLREALREQYVADFHAGWRRALGNIHLTDLESIPHAVIVIDALLGGGRPLERLLAEIERHTR
LYPELPVDDDVARDRLRGSSRYRLAGKLAAPFQPLHALHRKGEEADGDLAAVRAALGALRDHLRAVEQSS
EPGRIAYRHARNRLLQDSGDPVDRVERLAEELPAPLDGFMAGIAEQSWRLISGEAIRYLEQQWLDEVIAP
FEADLAGRYPLEPNARREVALEDFERFFAAGGTLDSFFMDKLQPFLDEAPELLEGPDGRSLLNPRLRTAL
ERAERIREAYFGRDGLLDVGFTLAPVSLSGDKRRSVLNVDGQILEYRHGAPQRVAMLWPNSLRQTNESGI
TLVPDRVNRSPRSERHQGAWAWFRLLDEARVVAVGERELRLSFQVDGGEMSYRLTADRTRNPFTRPLTRG
YTVPATLYRNGVGGR
 
Nucleotide Sequence: 3618 bp     [Download]
>gi|114319166|ref|NC_008340.1|:61425-65042 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGTCGGACAAGGCAAGGAATCGCGTGGCAGGACGCCTGCGCGGCACCATGGGCAGCGTAACGGGAGGGC
GGGTCAGCCGCTATTCGGGGTGGGTGGGCGCGCTCCGTCGCGGGTGGCCCTGGGTCGTGGGGCTGCTGGG
GATAGCATTGCTGGCGGTGGTCTGGATCTGGGGGCCGGCCTGGCAGATCGGTGGCGCCCGGCCCCTGGCC
CCCTGGCCGAACCGGCTGCTGGTCATTCTCTGCGCGGTGCTGGTCGTGCTGGTGATTATTGGGCTCCGCC
TCAGGGCCCGCCTGCGCGATGCCGAACCCCCCCGCGACGAGGCTGAGATCCCCGACCCGGTGGCCCAGGC
AACCGCCGGGCAGGAGCAGGGCCTGAATCATTGCTTGGACCAGTTGCGGCGCCAGCGCGGGCGCCACGCC
CTGCAGGCATTGCCCTGGTACCTCGTGCTGGGTCCGGAGGGCAGCGGCAAGACCAGTCTGGTGCAGCGCT
CGGGCCAGCGCTTTTCACTCACCCGGAGCCTCCACCCGCAGGGCGGTGAGGCCTCGGATAGCGGGCTGCG
CTGCTGGGCCAGTGACCGGGCCGTCACGCTGGAGCCCGGCGCCGCCTGGCTGTTGCAAGGGGGGTGGGAC
AGAGACGGTGCGGATGCCCTGAGCGCCTCCCTCTGGCAGCACCTGGTCGGCTGGCTGCAGCGGCGTCGCC
CCCGACGGCCGCTCGACGGCGTGCTCCTGGTGCTGGACCTGTCCCGGCTCACCAGCGCCGGCGCCCGGGA
CGACTGGGGCGATGCCCTGCGCGAACGCCTGCAGGAGCTGACCACGACCTATCAGAGCCGGCTTCCGGTC
TACGTGGTCTTCAGCCAGATGGATCGGTTGTACGGCTTTGACGCCTTCTTCCGGCACGCTGTCGGTGATG
CCCGCTGCGAGCCATGGGGCTTCTCCTTCAGCGCCGGCAGCCTGGCCGACCCGGACGCCTGGGAGGAGGA
GTTCACCGGCGCCTACCGACGCATGCTCGGCCGCATCGAACGGCAACTGGTCGCATGGCTGGCCGCGTGT
CGTGATCAGGGCGAACGGGAGGCCCTTTTCCGCTTCTCCCGACAGCTGGCCGGTCTCGAGCCCCTCCTGA
GCGAAACCCTGCAACGGGTGCTCGGCAGCCGGCGTTATGCCGTTGAACCGCTGGTGCGCGGGGTGTACTT
CGCCTCGCTCGGCCAGCAGGGGGTGCCCATCGATGCCTTTGCCGACGCGGCCACCGCCCGCTATCGCCTG
CCCGACCTGGTGCACCGTGCCCGCCGCAATGGCCAGCAGTCGCTGGCCTGGTTCTCGGAGCGGTTGCTGC
AGCGGGTGGTCTTCCCCGAGGCCGGCCTTGCCGGGGACAGCCTCCGCTTCGTCCGCCGCCGGCGTTGGCT
GCGCGGTGCCGGCCTGGTGTTCTCCCTGGCAGGGCTGAGCGGATTGGTCATCGGCTGGGGGCACTACTAT
CAGCACAATCTCGTGGCCCTGCAGGCCGTGGAGGCGAGGGCGGAGGCCCTGGCGGACCTGCGACCGGCGC
AGGAGCACCTCGACGACCCCAGCGGCCAGCACCTGGTGCCGGCGCTGGATGAGCTCCGCGAGGTCGCCGG
CGTCTTTGACGGACCCCGCGGGGCGTGGGCAGGCCTGGCGGATATGGGGCTCTACCAGGGGCACAGGGTC
GGTGATGCCATGGACCAGGCGTACCTGGACGCGCTCCGCTACCGGTTCCTGCCGGCCCTGATGCTCGGCA
TTGCCGACGAGATGAACACGCTGGCACCGGGGAGCGAGGAGCAGCTCGTCCGGCTCCGCGTCCTGCGCAT
GCTCGCCGATGCCCGCGGACGGGAACCGGATCGGGTGCGGGACTATATGGCCGATCGCTGGCAGGCGCTG
TTGCCCAACCGGGGGCGGCTGCAGGGCCGGCTGCTGGAGCACCTGGACCATGCCCTCGTCCATACCGACC
TGGCGGGCCGGCAGGCGCACGATCCCCGCGCGGCGGCCGCGCTGGCGCCGGTGGCCGGCAGCATCCGGAA
GGCCCAGCAGGCGTTCTCCCGCAGTCCGGTGGATGAGCGGGTCTATACCCTCCTGAAGCGCCGCGGGCAG
GACCGAGCCGGTGGCGGCGTAAGGCTGGACCGCAGCGTTGGGTCGGGTTGGGGCACGGTCTTCCGCGCCG
ATGACGATGATCCGGACGGGGTGACCGTATCGCCGCTGCTGACCCGTGACGGCTTTGAGCAGGTCTTTCT
CGGAGAGTTGGACGGCGCCACGGTCCTCGCCCTGAACGACCTCTGGGTGCTGGGCGAGCGGGACGACCCG
CAGTTCAGCGAGCGCGACGAGCAGCGCTTGCGGGAGGCCCTGCGTGAGCAGTATGTGGCCGACTTCCACG
CCGGTTGGCGCCGAGCCCTGGGTAACATCCATCTCACCGATCTGGAGAGTATTCCCCACGCCGTGATCGT
CATCGACGCGCTGCTGGGGGGCGGCCGTCCGCTGGAACGCCTGCTGGCCGAGATCGAGCGCCACACCCGA
CTCTACCCCGAACTCCCGGTGGATGACGACGTGGCCCGGGACCGGCTCAGGGGCTCGTCGCGCTACCGGC
TGGCCGGGAAGCTGGCCGCGCCCTTCCAACCCCTCCACGCCCTGCATCGGAAGGGGGAGGAGGCGGACGG
CGATCTGGCCGCCGTCCGGGCCGCACTGGGGGCATTGCGAGACCATCTGCGGGCGGTGGAGCAGTCCAGC
GAGCCGGGGCGCATCGCCTACCGTCACGCCCGCAACCGGCTACTGCAGGACAGCGGGGATCCGGTGGACC
GGGTGGAGCGGCTGGCCGAAGAGTTGCCTGCCCCGTTGGATGGATTCATGGCGGGTATCGCCGAGCAGAG
CTGGCGGCTGATCAGTGGTGAGGCCATCCGGTACCTGGAGCAGCAGTGGCTGGACGAGGTGATTGCCCCG
TTTGAGGCGGATCTGGCCGGCCGTTACCCGCTGGAACCGAACGCCCGGCGGGAGGTGGCGCTGGAGGACT
TCGAGCGCTTCTTTGCGGCGGGCGGCACCCTGGACAGCTTCTTCATGGACAAACTGCAGCCCTTCCTCGA
CGAGGCCCCGGAACTGCTGGAGGGGCCCGACGGGCGTTCGCTGCTCAATCCCCGGTTGCGGACGGCGCTG
GAGCGGGCGGAGCGGATCCGGGAGGCCTACTTTGGCCGGGACGGGCTGCTGGATGTCGGTTTCACCCTGG
CCCCGGTGAGCCTCAGCGGTGACAAGCGGCGTAGCGTGCTCAACGTGGACGGGCAGATTCTGGAGTATCG
CCACGGCGCCCCCCAGCGGGTCGCCATGCTCTGGCCCAACAGCCTGCGTCAGACCAATGAAAGCGGGATC
ACGCTGGTACCCGACCGCGTCAACCGTTCGCCGCGCAGCGAACGCCACCAGGGGGCCTGGGCCTGGTTCC
GCCTGCTCGACGAAGCCCGTGTGGTGGCGGTGGGCGAGCGGGAGCTGCGGCTCAGCTTCCAGGTGGATGG
CGGGGAGATGAGCTACCGCCTGACCGCGGACCGGACCCGCAATCCGTTCACCCGGCCGCTGACCCGGGGG
TACACGGTGCCTGCCACCCTGTACCGCAACGGGGTCGGCGGACGCTGA
 Primer design