SecReT6
Protein ID: 114563530
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2360
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2809539..2811395 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ080W0
KEGG IDsfr:Sfri_2360
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.70E-70, Aligned region: 30..335
Phage_base_V [PF04717], Evalue: 3.00E-27, Aligned region: 376..469
Protein Sequence: 618 a.a.     [Download]
>gi|114563530|ref|YP_751043.1| Rhs element Vgr protein [Shewanella frigidimarina NCIMB 400]
MLKATQKNNIISITTPLGKDTLYLTHFTATEAISQLFSISVSMFTVGTQISLDSLVGKNVCITLRNAESN
GAVRYFHGVVSHLESAGMRTAASDDAQNYIDYQAVIVPQMALMKKRSNCRIFQNKSVIDIVKDLFGQHKV
EFQNKTTNTYPKYEYCVQYLESDVDFVCRLLQQEGIFFFFEHSVSAHTLVLADDINAYKPCAEEKVRCFS
GHLAESHVSHWQGGMSMVSGGFIQKGYDYEQPKLYPSGNHTNANLPEQSALEVYDYLGESEFNKRAQPFA
NNQLEALQKDMNKCSGQGDCRSFMVGKFFTFKDHENASYKGKSFVISSLRTSATQPNQSGTSQSMSGSVY
QNDFECVPKSTPYRSQLHLRKPLINGVQTAVVTGEPGDEQHIDKFGRVKVQFHWDREGEFNSKSSCWIRV
AQSWAGNKWGAFFFPRVGQEVLVEFINGDPDQPIISGAVYNADLMPPYALPAKKTQSGIKTHSTKDGGAD
NFNELRFDDEKGKELLFLQAEKDHLLNVKHDQKDTIGNDRFTDIVNNDNVKIGNNRLEDIANNDSLKVGK
VLNIEAGNEIVIKTGSASIKMSSDGSISIEGTNITIKGTNVKVNGTSIALKAAQIKLN
 
Nucleotide Sequence: 1857 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2811395-2809539 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGCTTAAGGCCACTCAAAAAAATAATATCATCAGTATCACAACGCCATTAGGTAAGGATACTCTGTACC
TAACGCATTTTACTGCCACAGAAGCCATCTCTCAGCTTTTTTCAATCAGCGTCTCCATGTTCACGGTTGG
CACCCAGATTAGTCTCGACAGTTTAGTGGGTAAAAATGTTTGTATTACTTTACGTAATGCCGAAAGTAAT
GGTGCAGTTCGATACTTTCATGGGGTGGTAAGTCATCTTGAGTCTGCTGGAATGCGGACCGCAGCGTCAG
ACGATGCACAGAATTATATAGATTATCAAGCCGTTATAGTGCCTCAGATGGCATTGATGAAAAAACGCAG
TAATTGTCGAATTTTTCAAAATAAGTCAGTCATTGATATTGTTAAAGACTTGTTTGGTCAACATAAAGTT
GAATTTCAAAATAAAACCACCAACACCTACCCTAAATATGAATACTGTGTGCAGTATTTAGAATCAGATG
TCGATTTTGTTTGTCGTTTATTACAGCAAGAGGGAATTTTCTTCTTCTTCGAGCATAGTGTTAGTGCTCA
TACCCTAGTACTTGCTGATGATATAAACGCCTACAAACCTTGTGCAGAAGAGAAGGTTCGTTGTTTCTCA
GGTCATTTAGCCGAGTCGCACGTGTCTCATTGGCAAGGCGGCATGAGCATGGTGAGTGGCGGTTTTATTC
AAAAAGGTTATGACTACGAACAACCTAAATTATACCCATCAGGTAATCATACTAACGCAAATCTTCCTGA
ACAAAGTGCACTTGAGGTGTACGATTATTTGGGCGAGTCTGAGTTCAACAAGCGTGCTCAACCGTTTGCC
AATAATCAACTTGAAGCCCTGCAAAAAGACATGAATAAATGCAGCGGCCAAGGCGATTGTCGTAGTTTTA
TGGTGGGTAAGTTTTTTACTTTCAAAGATCATGAAAACGCGAGTTATAAAGGTAAGAGCTTTGTTATAAG
CTCACTGAGAACGTCGGCTACTCAGCCTAATCAGTCAGGCACAAGCCAATCAATGTCTGGCAGTGTTTAT
CAAAACGATTTTGAATGTGTTCCTAAAAGTACTCCTTATCGCTCACAGCTTCATTTACGTAAACCATTAA
TTAATGGGGTACAAACAGCGGTAGTGACTGGTGAACCTGGTGATGAACAACATATTGATAAATTTGGCCG
TGTAAAAGTACAGTTTCATTGGGATCGTGAAGGCGAGTTCAATAGTAAAAGTTCATGTTGGATCCGTGTC
GCACAAAGCTGGGCTGGCAACAAGTGGGGTGCATTCTTCTTCCCTCGCGTAGGCCAGGAGGTGTTAGTTG
AGTTTATCAATGGTGACCCTGATCAACCGATTATCAGCGGTGCGGTGTATAACGCAGACTTAATGCCTCC
TTATGCATTACCGGCTAAAAAGACTCAGTCTGGCATTAAAACCCATAGTACTAAGGACGGTGGTGCCGAC
AATTTCAATGAGTTACGTTTTGATGATGAAAAAGGCAAAGAGTTATTATTCCTCCAAGCAGAAAAAGATC
ATCTATTGAATGTAAAACATGATCAAAAAGACACCATAGGCAACGACCGTTTCACTGACATCGTTAATAA
CGATAACGTTAAAATTGGTAATAATCGACTAGAAGACATAGCCAATAATGACAGTTTAAAAGTCGGTAAA
GTACTTAATATTGAAGCGGGTAATGAAATTGTCATTAAAACCGGCAGCGCATCAATCAAAATGAGCAGCG
ACGGTTCGATTTCTATCGAAGGCACCAACATTACTATTAAAGGGACAAACGTTAAGGTTAATGGTACCAG
TATTGCCTTAAAAGCTGCTCAAATTAAGTTGAACTAG
 Primer design