SecReT6
Protein ID: 114563531
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2361
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2811466..2811945 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ080V9
KEGG IDsfr:Sfri_2361
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.80E-31, Aligned region: 6..133
Protein Sequence: 159 a.a.     [Download]
>gi|114563531|ref|YP_751044.1| hypothetical protein Sfri_2361 [Shewanella frigidimarina NCIMB 400]
MQANTYLDYEGIKGETTAEEFKDLITVLSVDWNISREITSFTGTAKDREASSTRLGDVTITKLQDNSSTD
LFKEATIGKGKKAVFHITKQGDKIEEIMQIELTDAMISSYSVSVHGDRPVETITISYTEMMMAVTPTDDK
NNITAALRYGYSGVKGQQM
 
Nucleotide Sequence: 480 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2811945-2811466 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGCAAGCGAATACATATTTAGATTATGAAGGGATTAAAGGCGAAACCACTGCTGAAGAATTCAAAGACC
TGATTACTGTGTTATCAGTCGATTGGAATATTAGCCGTGAGATCACTTCTTTCACTGGTACTGCAAAAGA
CCGTGAAGCAAGCTCAACTCGTTTAGGTGACGTGACCATTACTAAATTACAAGATAATTCTTCTACTGAC
TTGTTCAAAGAAGCGACTATCGGTAAAGGTAAAAAAGCGGTTTTCCACATCACTAAGCAAGGTGACAAAA
TCGAAGAAATCATGCAAATCGAATTAACTGATGCAATGATCTCTAGCTACAGTGTTTCAGTTCATGGTGA
CCGTCCTGTAGAGACAATCACTATCAGCTACACTGAAATGATGATGGCTGTTACGCCAACTGATGATAAA
AACAACATTACTGCAGCGCTACGTTATGGCTACAGCGGTGTTAAAGGTCAACAAATGTAA
 Primer design