SecReT6
Protein ID: 114563532
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2362
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2812315..2814921 [-]
ProductATPase
NoteTssH
UniProt IDQ080V8
KEGG IDsfr:Sfri_2362
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.90E-43, Aligned region: 225..251
AAA_2 [PF07724], Evalue: 6.90E-43, Aligned region: 601..769
AAA [PF00004], Evalue: 3.50E-21, Aligned region: 225..356
AAA [PF00004], Evalue: 3.50E-21, Aligned region: 607..725
ClpB_D2-small [PF10431], Evalue: 2.50E-14, Aligned region: 774..853
AAA_16 [PF13191], Evalue: 5.70E-14, Aligned region: 202..248
AAA_16 [PF13191], Evalue: 5.70E-14, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 5.70E-14, Aligned region: 475..475
AAA_16 [PF13191], Evalue: 5.70E-14, Aligned region: 576..631
AAA_16 [PF13191], Evalue: 5.70E-14, Aligned region: 671..699
AAA_5 [PF07728], Evalue: 5.00E-13, Aligned region: 225..301
AAA_5 [PF07728], Evalue: 5.00E-13, Aligned region: 606..726
AAA_22 [PF13401], Evalue: 5.90E-09, Aligned region: 144..215
AAA_22 [PF13401], Evalue: 5.90E-09, Aligned region: 224..311
AAA_22 [PF13401], Evalue: 5.90E-09, Aligned region: 395..446
AAA_22 [PF13401], Evalue: 5.90E-09, Aligned region: 604..639
Sigma54_activat [PF00158], Evalue: 3.40E-08, Aligned region: 205..305
Sigma54_activat [PF00158], Evalue: 3.40E-08, Aligned region: 606..724
AAA_14 [PF13173], Evalue: 2.40E-07, Aligned region: 225..336
AAA_14 [PF13173], Evalue: 2.40E-07, Aligned region: 605..700
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 218..286
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 606..640
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 717..742
Arch_ATPase [PF01637], Evalue: 3.90E-06, Aligned region: 204..240
Arch_ATPase [PF01637], Evalue: 3.90E-06, Aligned region: 278..373
Arch_ATPase [PF01637], Evalue: 3.90E-06, Aligned region: 604..644
AAA_19 [PF13245], Evalue: 6.70E-06, Aligned region: 225..246
AAA_19 [PF13245], Evalue: 6.70E-06, Aligned region: 604..629
AAA_17 [PF13207], Evalue: 1.20E-05, Aligned region: 225..300
AAA_17 [PF13207], Evalue: 1.20E-05, Aligned region: 605..644
AAA_17 [PF13207], Evalue: 1.20E-05, Aligned region: 790..808
AAA_25 [PF13481], Evalue: 4.60E-05, Aligned region: 225..294
AAA_25 [PF13481], Evalue: 4.60E-05, Aligned region: 604..627
AAA_25 [PF13481], Evalue: 4.60E-05, Aligned region: 669..690
NACHT [PF05729], Evalue: 4.90E-05, Aligned region: 225..252
NACHT [PF05729], Evalue: 4.90E-05, Aligned region: 606..631
Zeta_toxin [PF06414], Evalue: 6.00E-05, Aligned region: 134..172
Zeta_toxin [PF06414], Evalue: 6.00E-05, Aligned region: 221..246
Zeta_toxin [PF06414], Evalue: 6.00E-05, Aligned region: 599..647
DUF2075 [PF09848], Evalue: 9.70E-05, Aligned region: 225..327
DUF2075 [PF09848], Evalue: 9.70E-05, Aligned region: 605..641
AAA_18 [PF13238], Evalue: 0.00017, Aligned region: 225..258
AAA_18 [PF13238], Evalue: 0.00017, Aligned region: 607..641
NTPase_1 [PF03266], Evalue: 0.00053, Aligned region: 225..251
NTPase_1 [PF03266], Evalue: 0.00053, Aligned region: 606..634
RNA_helicase [PF00910], Evalue: 0.00074, Aligned region: 226..248
RNA_helicase [PF00910], Evalue: 0.00074, Aligned region: 607..630
RNA_helicase [PF00910], Evalue: 0.00074, Aligned region: 707..724
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 219..241
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 604..617
Clp_N [PF02861], Evalue: 0.0015, Aligned region: 36..68
Clp_N [PF02861], Evalue: 0.0015, Aligned region: 106..125
T2SE [PF00437], Evalue: 0.0015, Aligned region: 155..248
T2SE [PF00437], Evalue: 0.0015, Aligned region: 519..578
T2SE [PF00437], Evalue: 0.0015, Aligned region: 604..648
Hpr_kinase_C [PF07475], Evalue: 0.0018, Aligned region: 225..237
Hpr_kinase_C [PF07475], Evalue: 0.0018, Aligned region: 604..626
AAA_30 [PF13604], Evalue: 0.002, Aligned region: 213..266
AAA_30 [PF13604], Evalue: 0.002, Aligned region: 605..636
DUF258 [PF03193], Evalue: 0.0049, Aligned region: 214..247
DUF258 [PF03193], Evalue: 0.0049, Aligned region: 605..624
SRP54 [PF00448], Evalue: 0.008, Aligned region: 225..253
SRP54 [PF00448], Evalue: 0.008, Aligned region: 605..640
UPF0079 [PF02367], Evalue: 0.0097, Aligned region: 225..248
UPF0079 [PF02367], Evalue: 0.0097, Aligned region: 597..635
Protein Sequence: 868 a.a.     [Download]
>gi|114563532|ref|YP_751045.1| ATPase [Shewanella frigidimarina NCIMB 400]
MSAMTLSKLVGKLNPVCRQSLETAASVCHSRSQFSVEIEHWLLALLENGSGDLDIIMASFSVQKDQLISD
IRQGLEKFKTGNSAAPSLSPHIVSLLRQTWLNTSIEFNDSEIRTAYLIFTLLTDDSLNSLVSCSAKQLLK
IDPAQLKHAWPQLARQSTEHKVSSSDIEETQAMQSAPSKTPNLDQFTQNLTEQAELGKIDPILGRDNEIR
QMIDILTRRRQNNPILTGEAGVGKTAVVEGLALKIAQKEVPTALQNVRIHVLDLALLQAGAGVKGEFENR
LKALIKEVKQSVKPIILFIDEAHTMIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKFFEKDAA
LTRRFQVVKIEEPSPEQAIAMMRGLLPVMEGHHKILVSDQALCAAVNLSHRYITGRQLPDKAVSLLDTAC
ARVAMSQASTPGMVESLQRQIQQLDTQISILTREQKTGSDHKKSITELTKKHKLLSKELAPLTTQWQDEL
VTVQKIAELVGQIQASETDTAPLLVELTAFKAILSANKQPMVHWQVDEQLVAEVISDWTGIPAGKMQDDE
IKTILNLKDTMAKRVIGQDHALDLIAKTVQTSRAQLGDEKRPIGVFLLTGPSGVGKTETALTLAEQVYGS
EDNVTVINMSEFKEEHKVSLLLGSPPGYVGYGEGGVLTEAVRRKPYSVILLDEMEKAHPGVQDIFYQVFD
KGTIKDGEGRDIDFKNTIIIMTSNAGTETTMGLFEDEKIAPSIKGLRKALQDDLLSYFKPAFLGRLNVIP
YIPLTQLMLNEITKLQLQRVANRLAEHYQAKFTYSDDVVSQIVSMCQDAGSGARNVHNILQNTMLPDLSI
KILHNMANNKKTTNVKVNVVNDEFIYKI
 
Nucleotide Sequence: 2607 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2814921-2812315 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGTCAGCGATGACTTTAAGTAAATTGGTAGGAAAACTTAATCCAGTATGTCGACAATCTTTAGAAACCG
CTGCCAGCGTATGCCATAGCCGCAGCCAATTCAGCGTTGAGATTGAGCATTGGTTATTAGCGTTGCTAGA
GAATGGTTCGGGTGATTTAGACATCATCATGGCCAGTTTTTCAGTACAAAAAGATCAGTTGATTAGTGAT
ATCCGTCAGGGATTAGAAAAGTTTAAAACAGGCAACAGTGCAGCACCAAGCTTGTCACCACATATAGTAA
GTTTGCTTCGTCAAACTTGGTTAAATACCAGTATTGAATTCAACGATAGTGAGATAAGAACTGCCTATCT
GATTTTTACCTTGCTGACTGACGATTCATTAAACTCTTTGGTTTCGTGCTCTGCAAAACAGCTCCTTAAA
ATAGATCCTGCACAGCTAAAACATGCATGGCCACAGCTTGCTCGTCAATCTACCGAGCATAAAGTGTCAA
GTAGCGATATCGAAGAAACTCAGGCGATGCAGTCTGCGCCGAGCAAAACACCAAATCTAGACCAATTTAC
CCAAAATTTAACCGAGCAAGCAGAACTGGGGAAAATAGATCCTATTCTTGGACGTGATAATGAAATTAGG
CAGATGATCGACATTTTAACCCGTCGCCGTCAAAATAATCCTATTTTAACGGGTGAAGCCGGTGTTGGTA
AAACCGCTGTTGTGGAAGGTTTAGCGCTTAAAATTGCCCAGAAAGAAGTTCCGACTGCATTACAAAATGT
TCGTATTCATGTACTGGATTTAGCCTTACTACAAGCTGGAGCCGGAGTGAAAGGGGAATTTGAGAACCGC
TTAAAAGCTTTAATTAAAGAAGTTAAACAGTCTGTTAAACCTATTATTTTATTTATAGATGAAGCTCACA
CCATGATTGGCAGCGGCGGACAAGCTGGACAAAATGACGCGGCAAATTTATTAAAACCCGCATTAGCGCG
TGGTGAGTTACGTACCATTGCGGCAACAACATGGGCAGAATATAAAAAGTTTTTTGAAAAAGATGCCGCA
TTAACTCGTCGTTTTCAAGTGGTTAAAATTGAAGAGCCTTCTCCTGAACAAGCTATTGCAATGATGCGGG
GCTTGTTACCTGTAATGGAAGGGCACCATAAAATTCTTGTTTCCGATCAAGCTTTATGTGCTGCAGTTAA
CTTATCTCATCGATATATTACTGGCCGACAACTGCCAGATAAAGCGGTAAGTTTATTAGATACTGCATGC
GCTCGTGTTGCTATGAGTCAAGCTTCTACTCCTGGAATGGTTGAATCATTACAACGACAAATTCAGCAAC
TAGACACACAAATTAGCATTCTAACTCGTGAGCAAAAAACAGGTTCAGATCATAAAAAGTCTATTACAGA
GTTAACCAAAAAACATAAATTGCTTTCAAAAGAACTCGCTCCTTTGACAACACAATGGCAGGACGAATTA
GTTACCGTTCAAAAAATTGCAGAATTAGTTGGCCAGATTCAAGCATCAGAAACAGATACCGCACCTTTGT
TAGTGGAGTTAACGGCGTTTAAGGCAATATTGTCAGCCAATAAACAGCCTATGGTGCATTGGCAAGTTGA
TGAACAATTGGTTGCTGAAGTCATTTCTGATTGGACTGGCATTCCTGCAGGTAAAATGCAGGATGATGAA
ATAAAAACAATTTTGAACTTAAAAGACACCATGGCCAAGCGCGTTATCGGCCAAGATCATGCCTTAGATT
TAATCGCCAAAACAGTGCAAACGTCTCGTGCACAGTTGGGTGATGAAAAACGTCCCATTGGTGTATTTTT
ACTGACAGGCCCTAGCGGCGTAGGTAAAACAGAAACGGCATTAACATTGGCTGAGCAAGTTTATGGTAGC
GAAGATAATGTAACTGTCATCAACATGTCTGAATTTAAAGAAGAACATAAAGTGTCATTACTTTTAGGTT
CACCTCCAGGTTATGTTGGTTATGGTGAAGGTGGAGTGCTGACTGAAGCCGTTCGCCGTAAACCTTATAG
TGTTATTTTGCTGGATGAAATGGAAAAGGCACATCCAGGTGTTCAAGATATTTTTTATCAAGTTTTTGAT
AAAGGCACCATTAAAGATGGTGAGGGGCGTGATATAGATTTCAAAAATACTATTATCATTATGACCTCAA
ATGCTGGTACAGAAACCACGATGGGCTTATTTGAAGATGAAAAAATTGCGCCATCAATTAAAGGTTTACG
CAAAGCACTTCAAGATGATTTATTGAGTTATTTCAAACCGGCTTTTTTAGGCCGTTTAAATGTAATCCCT
TATATTCCGTTGACCCAACTAATGCTCAATGAAATCACTAAATTGCAATTACAGCGAGTTGCTAATCGTT
TAGCTGAGCATTATCAAGCTAAGTTCACTTACAGTGATGATGTGGTGAGCCAAATTGTGTCTATGTGTCA
GGATGCTGGTTCAGGTGCTCGCAATGTGCATAATATTTTACAAAATACTATGTTGCCTGACCTTTCGATC
AAAATCTTACACAATATGGCTAACAATAAGAAAACAACCAATGTAAAAGTAAATGTAGTAAACGATGAGT
TTATTTATAAAATCTAA
 Primer design