SecReT6
Protein ID: 114563533
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2363
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2814941..2815948 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ080V7
KEGG IDsfr:Sfri_2363
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.90E-84, Aligned region: 15..318
Protein Sequence: 335 a.a.     [Download]
>gi|114563533|ref|YP_751046.1| hypothetical protein Sfri_2363 [Shewanella frigidimarina NCIMB 400]
MTQQVMNNQLQAIIDTPSEHDFYQAVYQFQQQLSQGREQGYKVGYDAIPSQELLRFKSDQHLGFPGQAIS
KVAPTSTSQTDKVAADLHISFMGLTGPSGVLPSHYTELLLERLRLKDNGMRDFYDLFNHRLISLFYRSWE
KYRFSANYQSPETGVTDSFTHVLSLLSGNKSLNRYYAGFCHTKTPSAESLRRMLNDFTGCNVNILSFQGR
WQSLAKTEQTRMASRSMPEGQYARLGVDASIGNRVWDINSSVSIHIKPKEGASVNAFMPGTASYQSLKKL
VSNYLGQSVKYKIFLEIKQQDAPTAQLSKSAIGLGLGCGLMSRAENGQQIKSLMI
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2815948-2814941 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGACCCAGCAAGTAATGAATAATCAGTTGCAGGCGATAATCGATACGCCATCAGAACATGACTTTTACC
AAGCCGTTTATCAGTTTCAACAACAATTATCTCAAGGGCGAGAGCAAGGTTATAAGGTGGGTTATGACGC
CATTCCCAGCCAAGAGTTGTTACGTTTTAAGTCTGATCAACATCTTGGTTTTCCAGGACAAGCAATCAGC
AAAGTAGCGCCTACATCGACAAGTCAAACTGATAAAGTTGCCGCCGATTTGCATATATCATTTATGGGAT
TAACCGGACCCAGTGGTGTTTTGCCTTCACATTATACTGAGTTGCTACTAGAGCGCCTGCGGCTTAAAGA
TAATGGGATGCGTGACTTTTATGATTTATTTAACCATCGGCTGATCTCACTATTCTATCGTTCATGGGAA
AAGTATCGTTTTTCGGCAAATTATCAATCCCCTGAAACAGGCGTTACCGACAGCTTTACCCATGTATTGA
GTTTGCTTAGTGGTAACAAATCATTAAATCGCTATTACGCAGGTTTTTGTCACACTAAAACGCCGAGTGC
TGAGTCGTTACGAAGAATGCTAAATGATTTTACTGGCTGTAATGTAAATATTTTGTCTTTTCAAGGACGT
TGGCAGTCTCTCGCGAAAACAGAGCAAACCCGAATGGCCAGTCGAAGTATGCCAGAAGGGCAATACGCCC
GTTTAGGTGTTGATGCCAGTATAGGTAACCGGGTATGGGATATTAATTCAAGTGTCAGTATTCATATAAA
GCCGAAGGAAGGCGCATCGGTTAACGCTTTTATGCCTGGAACAGCCAGTTATCAATCACTTAAAAAACTA
GTCTCAAACTATTTAGGCCAGTCAGTGAAATACAAAATTTTTCTAGAAATAAAACAACAAGATGCACCTA
CAGCTCAATTATCAAAGTCCGCAATCGGACTAGGGTTAGGTTGTGGCCTAATGAGCCGTGCAGAGAATGG
ACAACAAATAAAAAGCTTAATGATTTAA
 Primer design