SecReT6
Protein ID: 114563534
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2364
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2815945..2817774 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ080V6
KEGG IDsfr:Sfri_2364
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.00E-200, Aligned region: 5..609
Protein Sequence: 609 a.a.     [Download]
>gi|114563534|ref|YP_751047.1| hypothetical protein Sfri_2364 [Shewanella frigidimarina NCIMB 400]
MNQELLEYYNRELAFIRHMGAEFAEQYPKVAGRLRLSDEHVEDPHVSRLIEAFSLLTAQIRQKLDDSFPE
LTEALLGQLYPDYQAPIPSMSVIKVTTENLSTTGVLLPRATQVDTQVEGMKTCHFQTSYDMKLWPIEVQK
AQFQNAPFNAPEPQCPERAKAIIKLDIACEFDEISMPSLGVDKLRFFLNGQDHQTFQLYQLLFEHSLGFA
LVNEQQTVCKFLTKRHLKAVGFEDEQQVIPYSQRTSSGYRLLLENFIFPEKFLFFDIDDLDGSWQGIDNK
FSLYIYLKEGSQDLEKQVSANHFLLGCTPVINLFEQKLEPVSIDASQYEYKLAARYSDSEVTEIISIEDV
IAYDPKDNKVEVTPFYGESHPQYLGHNNLFWHVRRESASWSGGYAELGTESFLSLVDHNFKGFKSEDDYG
AWILSITAQCSNRNLPAHLPFGTNEPKMFVPERADIIKHVKCLLAPTLPVRASLSDASRWQLVTHLSIDS
FSGKDALSNLKETLKLYDFKCSPENKNLIENIHSVQVSPDTARVNQHGRISFCSGSHIEITFIKDHYSGS
GVFFFCTILDHFFAQFAAINSFTRLSMRFKDHNSIAYTWPARAGQRPLL
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2817774-2815945 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
GTGAATCAGGAATTATTGGAATATTACAATCGTGAGCTGGCTTTCATTCGTCATATGGGAGCGGAATTTG
CTGAGCAATATCCTAAAGTGGCCGGGCGTTTACGCTTAAGTGATGAACATGTTGAAGATCCTCATGTTTC
ACGATTAATTGAAGCATTCTCTTTGCTAACAGCACAAATTAGGCAAAAACTTGACGATAGTTTTCCTGAA
TTAACCGAGGCGTTATTAGGCCAGTTATATCCCGATTACCAAGCGCCAATACCGTCTATGTCAGTTATCA
AAGTCACCACTGAAAACTTGTCGACTACTGGCGTGTTATTACCCAGGGCAACTCAGGTAGACACTCAGGT
AGAGGGGATGAAAACGTGCCATTTTCAAACATCATATGACATGAAATTATGGCCCATTGAAGTGCAAAAA
GCCCAGTTTCAAAATGCACCGTTTAATGCCCCAGAACCACAATGTCCAGAACGTGCTAAAGCGATTATTA
AGCTTGATATCGCCTGTGAATTTGACGAAATTAGCATGCCGAGCCTTGGGGTTGATAAATTACGCTTTTT
CTTGAATGGCCAAGATCATCAAACGTTTCAGCTTTATCAATTGTTATTTGAACACAGCCTAGGTTTTGCT
TTAGTGAATGAGCAGCAAACTGTGTGTAAGTTTTTAACCAAAAGGCATTTAAAAGCGGTTGGCTTTGAAG
ATGAACAACAAGTCATACCTTACAGCCAACGTACTAGTTCTGGTTATCGATTATTATTAGAAAATTTTAT
TTTTCCAGAAAAATTCTTGTTTTTTGACATTGATGATTTAGACGGCAGCTGGCAAGGGATCGACAATAAG
TTTTCTCTTTATATATATTTAAAGGAAGGCTCTCAGGATTTAGAGAAGCAAGTTAGTGCCAATCATTTTC
TGTTAGGTTGTACGCCAGTGATTAATTTGTTTGAACAAAAATTAGAACCGGTGAGTATTGATGCGTCTCA
GTATGAATATAAATTGGCTGCCCGTTATTCTGACTCTGAAGTGACTGAAATCATCAGCATTGAAGATGTT
ATTGCTTATGATCCTAAGGACAACAAGGTAGAAGTTACCCCATTTTATGGTGAATCGCATCCGCAATATT
TAGGTCATAATAATTTGTTTTGGCATGTTAGACGTGAGTCTGCTAGTTGGTCTGGTGGGTATGCTGAATT
AGGCACTGAATCATTTTTATCTCTAGTCGATCATAACTTTAAAGGATTTAAGTCCGAAGACGACTATGGC
GCTTGGATATTAAGTATTACCGCTCAATGCAGCAACCGTAATTTACCGGCGCATCTCCCGTTTGGTACTA
ATGAGCCAAAAATGTTCGTACCTGAACGTGCCGACATTATTAAGCACGTAAAATGTTTGCTTGCGCCCAC
GTTACCGGTACGTGCGTCGCTGAGCGATGCTTCGCGCTGGCAGCTAGTGACTCATTTATCTATTGATAGT
TTTAGTGGTAAAGATGCACTGTCTAACTTAAAAGAAACCCTTAAATTATACGATTTTAAGTGTTCACCAG
AAAATAAAAACTTAATAGAGAATATCCATTCTGTTCAAGTGAGCCCCGATACAGCCAGAGTTAACCAGCA
TGGCAGGATTAGCTTTTGCAGTGGCAGTCATATTGAAATTACCTTTATTAAAGACCATTATTCTGGCAGT
GGCGTGTTTTTCTTTTGCACTATTTTAGACCACTTCTTTGCACAATTTGCTGCAATCAATAGTTTTACTC
GCTTGAGCATGCGCTTTAAAGATCATAATTCGATAGCTTATACCTGGCCAGCACGAGCTGGACAAAGGCC
GCTGCTATGA
 Primer design