SecReT6
Protein ID: 114563535
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2365
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2817771..2818235 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ080V5
KEGG IDsfr:Sfri_2365
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.90E-20, Aligned region: 27..132
Protein Sequence: 154 a.a.     [Download]
>gi|114563535|ref|YP_751048.1| hypothetical protein Sfri_2365 [Shewanella frigidimarina NCIMB 400]
MASILDRLIDDAPNEQDVKDSHRGLNLRQLRSNVRRDLENLLNAKLQWQTWPDHLTELDNSLMNYGLRDF
SSMPVASLDGRQLLCKQVADTIKRFEPRFLEVMVETVDNEQPLDRVLRLKINALLYAEPEPEYITFDSEV
EPVHLAMIVNEGIL
 
Nucleotide Sequence: 465 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2818235-2817771 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGGCGTCAATTCTAGATAGATTGATAGATGATGCGCCAAATGAGCAAGATGTCAAAGACAGCCATCGTG
GCCTTAATTTACGTCAGTTAAGGTCTAATGTTCGTCGCGATTTAGAAAATCTACTCAATGCTAAATTGCA
ATGGCAAACGTGGCCGGATCATTTAACTGAGCTTGATAATTCTTTGATGAATTATGGTTTACGTGACTTT
TCTTCTATGCCAGTCGCGAGCTTAGATGGGCGTCAACTTTTATGTAAACAAGTTGCCGATACCATAAAAC
GATTCGAACCGAGATTTTTAGAAGTGATGGTTGAAACAGTTGATAATGAACAACCATTAGATCGGGTTTT
AAGATTAAAAATTAATGCATTGTTGTATGCAGAACCTGAGCCTGAATATATTACGTTTGACTCGGAAGTT
GAGCCTGTCCACTTGGCGATGATAGTTAATGAGGGAATTCTGTGA
 Primer design