SecReT6
Protein ID: 114563536
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2366
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2818268..2819056 [-]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDQ080V4
KEGG IDsfr:Sfri_2366
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.70E-37, Aligned region: 138..257
TPR_14 [PF13428], Evalue: 7.40E-05, Aligned region: 5..33
TPR_14 [PF13428], Evalue: 7.40E-05, Aligned region: 39..68
TPR_19 [PF14559], Evalue: 0.00016, Aligned region: 7..63
TPR_19 [PF14559], Evalue: 0.00016, Aligned region: 101..112
Protein Sequence: 262 a.a.     [Download]
>gi|114563536|ref|YP_751049.1| virulence protein, SciE type [Shewanella frigidimarina NCIMB 400]
MKQIQQMLQSGQLQDAIQLVETQLKDDPMNIDLKGQHVELLCINGELERADKQLNFLVQKHPDFLIGAAN
LRQLIRAEQARQDFMAGKAVPQLFAESDAHVEALMKLRLAMVDAQDDVTQCANSLETLRPEINLVLNDIT
HQEIRDLDDTLGGFIEIFGTDGNFYLAQLSEIDYINFKPVTSLLEMVWRRVDLAIKNGPSGEAHIPMIYG
GSETDAQKLGRETDWHEIATNVVAGKGLKMWFVDDNAIALNQITKVTTPVLQ
 
Nucleotide Sequence: 789 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2819056-2818268 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGAAACAAATTCAACAAATGCTACAGAGCGGCCAACTACAAGATGCAATTCAGTTAGTTGAGACACAAT
TAAAAGACGACCCGATGAATATTGACTTAAAAGGTCAACATGTTGAGTTGTTGTGTATTAATGGTGAACT
TGAGCGTGCAGACAAACAATTAAACTTTTTAGTGCAAAAGCATCCCGACTTTTTAATTGGCGCAGCAAAT
TTACGTCAGCTGATCCGTGCTGAACAAGCCCGACAAGATTTTATGGCGGGCAAAGCTGTACCACAACTTT
TTGCTGAGTCTGATGCGCACGTTGAAGCATTAATGAAATTACGTTTAGCAATGGTTGATGCTCAAGATGA
TGTGACTCAGTGTGCAAACAGCCTTGAAACTCTGCGTCCGGAAATAAACTTAGTATTAAATGATATCACT
CATCAAGAAATTCGTGATTTAGATGACACTTTAGGTGGTTTCATCGAAATTTTTGGTACTGACGGCAATT
TTTATTTAGCGCAGTTATCTGAAATTGATTATATCAATTTTAAACCTGTAACTTCATTACTGGAAATGGT
TTGGCGCCGGGTTGATCTTGCCATTAAAAATGGACCAAGTGGTGAAGCGCATATTCCAATGATTTATGGT
GGCAGTGAAACTGATGCGCAAAAACTGGGACGAGAAACCGATTGGCATGAAATCGCGACTAATGTTGTTG
CTGGCAAGGGCTTAAAGATGTGGTTTGTCGATGATAATGCTATCGCATTAAATCAAATAACTAAAGTTAC
GACTCCAGTGTTGCAGTAG
 Primer design