SecReT6
Protein ID: 114563537
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2367
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2819071..2820606 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ080V3
KEGG IDsfr:Sfri_2367
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.80E-170, Aligned region: 75..507
Protein Sequence: 511 a.a.     [Download]
>gi|114563537|ref|YP_751050.1| hypothetical protein Sfri_2367 [Shewanella frigidimarina NCIMB 400]
MPHETISFVTSEIFKEDTGINKPVSSTTQALKNKHLVERFLRESDSTRSLLLWLENSSHSLEQFDKTSVL
PFLLKAIERIDRQLEQQLNAIIHHDAFQALEASWRGVLYLVQQQDLHDKDQKVKVKMLDCCWTTLSKDIN
RAIEFDQSDFFKLIYNNEYDMSGGEPFGTLIGDYQITHKSRPGVSTNDIDILKEISRTAAAAFAPFITSA
SPSLFGADDFSDLSAHMNIAKIFEQHEYIKWNSLRKMDDSRFIGLTMPNILMRSPYLIDGTRSEGFKFKE
SIKNPKKDHLWGNAAYAFGGVLIRAFSESGWFGHIRGLEPGARKKGLVCDLAVSQYEPDLYRKRMKPSVD
LLISDRAEKSISDQGFIPLSPVLGCEHLVFYSNASVQKPPKYELLEDSINAKLSSMLQYILCVSRFAHYI
KVLGREKIGSLHSAEACQRELQLWLHKYTTASDVSSDDVRSKYPLRSAQVQVKEMRGKPGHFYSIIQLQP
HFQLDQMVSSIKLVTELTSRN
 
Nucleotide Sequence: 1536 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2820606-2819071 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGCCGCATGAAACCATTTCATTTGTAACAAGTGAAATTTTCAAAGAAGATACTGGTATTAACAAACCAG
TATCTTCGACTACACAGGCACTAAAAAATAAACACCTAGTCGAACGGTTCTTACGAGAGTCGGACTCGAC
TAGGTCGTTATTGCTGTGGCTTGAAAACTCAAGCCATTCGCTTGAACAATTCGATAAAACATCTGTTTTA
CCTTTCCTGCTTAAAGCCATTGAACGCATTGATAGACAATTAGAACAACAGCTTAACGCTATTATTCATC
ATGATGCATTTCAGGCGTTAGAAGCCAGTTGGCGTGGGGTACTTTATCTTGTTCAACAGCAGGATTTACA
TGATAAAGACCAGAAAGTGAAAGTGAAAATGCTCGATTGTTGTTGGACAACGCTGTCTAAAGACATTAAT
CGGGCCATTGAGTTTGATCAAAGTGATTTTTTTAAACTGATTTACAATAATGAATACGACATGTCTGGTG
GCGAACCCTTCGGCACATTAATTGGTGATTATCAAATCACTCATAAAAGCCGTCCTGGTGTCTCTACTAA
TGATATTGATATTTTAAAAGAAATATCCCGCACTGCAGCCGCCGCTTTTGCGCCCTTTATTACCTCGGCT
AGTCCTTCTTTGTTTGGTGCTGATGATTTTTCCGATTTATCTGCTCATATGAATATCGCCAAAATTTTTG
AACAACACGAGTACATTAAGTGGAATTCGTTACGTAAAATGGACGATTCTCGCTTCATTGGGTTAACAAT
GCCTAATATTCTCATGCGTTCTCCTTATCTCATTGATGGTACTCGTAGCGAAGGATTTAAGTTTAAAGAA
TCGATTAAAAACCCTAAAAAAGATCATTTATGGGGCAATGCTGCTTATGCATTCGGTGGGGTATTAATTC
GTGCATTTAGTGAATCTGGCTGGTTTGGTCATATCCGTGGGCTAGAGCCTGGGGCTCGTAAGAAAGGATT
AGTTTGCGATCTTGCTGTGAGCCAATATGAGCCGGATTTGTATCGGAAACGCATGAAGCCATCGGTGGAC
TTATTAATCAGTGATCGGGCAGAAAAGTCTATTTCAGACCAAGGTTTTATTCCTTTATCTCCGGTTTTAG
GTTGTGAACACTTAGTTTTTTACAGCAATGCTTCTGTCCAGAAACCACCTAAATATGAATTGTTGGAAGA
CAGTATTAATGCAAAGTTATCATCGATGTTGCAGTACATTCTGTGTGTTTCACGTTTTGCTCATTACATC
AAAGTACTAGGGCGCGAAAAAATTGGTTCACTTCATTCTGCAGAGGCTTGCCAGCGAGAGCTACAACTGT
GGCTGCATAAATACACTACCGCTTCAGACGTGTCTTCAGATGATGTAAGAAGTAAATACCCACTGCGAAG
TGCCCAAGTACAGGTAAAAGAAATGCGTGGCAAGCCAGGGCATTTCTATTCGATTATTCAGTTACAACCT
CATTTTCAGTTAGATCAGATGGTGTCCAGTATTAAATTGGTCACTGAACTGACATCAAGAAATTAA
 Primer design