SecReT6
Protein ID: 114563539
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2369
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2822151..2822651 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ080V1
KEGG IDsfr:Sfri_2369
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-60, Aligned region: 7..162
Protein Sequence: 166 a.a.     [Download]
>gi|114563539|ref|YP_751052.1| hypothetical protein Sfri_2369 [Shewanella frigidimarina NCIMB 400]
MSVHDKLKRVRKPRVHITYDVETEGTVVKKELPFVIGVTGDFTGHNTADLKPLKDRRFVQIDRDNFNDVL
KRMSPQLNISVPNTLAGDDTEMKVALQFSSIEDFEPAAIVNQVEPLKKLMETRNKLRDLMTKVDRSENLE
NILEEVLNNTTSLDRLAGELNLKGAE
 
Nucleotide Sequence: 501 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2822651-2822151 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGAGTGTACATGATAAATTAAAGCGAGTAAGAAAACCTCGTGTTCATATTACCTACGATGTTGAAACAG
AAGGTACAGTTGTAAAAAAAGAACTGCCTTTTGTTATCGGTGTTACGGGTGATTTTACTGGACACAACAC
CGCAGATTTAAAGCCATTGAAAGACCGCCGTTTTGTGCAAATCGATCGCGACAACTTCAATGATGTATTA
AAGCGTATGAGTCCCCAATTAAACATTTCAGTACCTAACACGCTTGCCGGTGATGATACTGAAATGAAGG
TAGCATTACAATTTAGCAGCATCGAAGACTTCGAGCCTGCAGCTATTGTTAATCAGGTTGAACCATTGAA
AAAATTAATGGAAACCCGCAACAAACTCCGTGATTTGATGACCAAAGTTGATCGTTCTGAGAATCTCGAA
AATATCTTAGAAGAAGTGTTAAATAACACAACCAGCCTAGATAGATTAGCTGGTGAACTTAACCTCAAAG
GAGCGGAATAA
 Primer design