SecReT6
Protein ID: 114563540
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2370
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2822693..2823799 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDQ080V0
KEGG IDsfr:Sfri_2370
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-20, Aligned region: 67..127
Protein Sequence: 368 a.a.     [Download]
>gi|114563540|ref|YP_751053.1| ImpA domain-containing protein [Shewanella frigidimarina NCIMB 400]
MSKLKNLTIDELILPISIDAESGVDPREDISPTSTYYLLKDVRNIARSRERKALTDEEDVLSVAVEWRPI
FEQVPDILKQQSKDIEYVAWFIEAACRLYGFKGLYFGFTLATELVERYWDTIYPTPEPNDLAERIAPLIG
LNGIESEGSLIHPIRTIPITDGGVIYSTWQYEQALDTSRLDKDKQEKRFDSGSVSLEDVEHSIRETSDSF
FIELDRDVQDAIAAFSKLSAAMDAAMSGEPQPTSYIRKALEACALQISTITAPIIAKNKTKLEQEQHHEE
EQHSDTNEHSTTSSGVDGQLNSRAQAINNLETIADFFRRTEPHSPMSYAIEQVIRWSDLSLPELLQELIQ
DGEARNGFFKLSGIKTED
 
Nucleotide Sequence: 1107 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2823799-2822693 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
TTGAGTAAGCTAAAGAATTTAACAATTGATGAATTAATTCTTCCCATTTCTATTGATGCGGAGTCAGGAG
TTGATCCTCGTGAAGATATAAGCCCGACATCAACTTATTATTTACTTAAAGACGTGCGAAATATTGCACG
TTCTAGAGAACGTAAAGCACTGACAGACGAAGAAGATGTATTGTCAGTTGCAGTTGAATGGCGACCAATT
TTTGAACAAGTCCCTGACATTTTAAAACAACAATCAAAAGATATTGAATATGTTGCTTGGTTTATAGAGG
CCGCCTGTAGGTTATATGGCTTTAAAGGACTTTATTTTGGTTTCACTCTGGCCACAGAGCTAGTTGAGCG
CTATTGGGACACTATCTATCCCACCCCTGAGCCAAATGATTTAGCTGAGCGCATTGCGCCGCTCATTGGT
TTAAACGGTATCGAAAGCGAAGGTTCTTTAATTCATCCAATCAGAACGATCCCAATCACTGATGGTGGTG
TTATTTATTCTACTTGGCAATATGAACAAGCTTTAGACACCAGTCGTTTAGATAAAGACAAGCAAGAAAA
GCGTTTTGATTCAGGTTCTGTATCACTTGAAGATGTCGAACATAGCATTAGAGAAACCTCAGACAGTTTT
TTTATTGAATTAGACCGAGATGTGCAAGATGCCATTGCAGCTTTTAGCAAGCTATCTGCTGCCATGGATG
CAGCAATGAGCGGTGAGCCACAGCCTACAAGTTATATTCGCAAGGCATTAGAAGCATGTGCGTTGCAAAT
CAGCACGATAACAGCGCCAATTATTGCAAAAAACAAAACAAAACTTGAACAAGAACAACATCACGAAGAA
GAGCAACACAGCGACACTAATGAGCACAGCACAACGTCATCAGGTGTCGATGGCCAGCTTAACTCAAGAG
CACAAGCCATTAATAACCTTGAAACGATAGCGGACTTTTTTAGACGAACCGAACCGCATTCGCCTATGTC
TTATGCTATTGAACAAGTTATTCGTTGGAGTGATCTCAGTTTGCCTGAGTTGTTACAAGAATTAATCCAA
GATGGTGAAGCAAGGAATGGTTTCTTCAAGTTATCTGGAATAAAAACGGAAGATTGA
 Primer design