SecReT6
Protein ID: 114563543
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2373
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2825557..2829105 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDQ080U7
KEGG IDsfr:Sfri_2373
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.50E-95, Aligned region: 201..456
ImcF-related_N [PF14331], Evalue: 8.50E-95, Aligned region: 914..951
IcmF-related [PF06761], Evalue: 7.40E-80, Aligned region: 327..372
IcmF-related [PF06761], Evalue: 7.40E-80, Aligned region: 511..811
DUF1215 [PF06744], Evalue: 6.10E-35, Aligned region: 924..1041
YajC [PF02699], Evalue: 0.0055, Aligned region: 52..91
Protein Sequence: 1182 a.a.     [Download]
>gi|114563543|ref|YP_751056.1| ImcF domain-containing protein [Shewanella frigidimarina NCIMB 400]
MSLKSIGKGIVDTLKSKWAITIIGFLCLALLIWFGGPLVAIAGYEPLASAATRVILLLVIVIIFGAIHFT
RQLKNKKQSEKMVDSLINGEEGNSVTGDDLAKSEITVLQNKMTQALDILKNTKLTKNKSIYELPWYIMIG
PPGSGKTTAIQHSGLEYPLKEKMGVDMIEGVGGTRHCDWWFTNKAVLIDTAGRYTTQDSHVKQDSRAWQG
FLGLLKKYRPVRPINGVIISMGMSDLLNQTKTERNLHARAIKQRLQELQNQLGMTFPVYVLFSKSDLVAG
FNEFFDDLTKEDCEQIWGITFPLNADTEDTDIVSSFNKEFHDLLLNLNARLNSRLKNERDLERRAAIYEF
PKQLRLLQSSADDFLKEIFAPNAYEEAPLLRGVYLTSATQEGTPIDHLSSHLSSGIKSKAKTFAANKQRS
YFIKRLLEDVIFPEKNLASTNRKHTNHNKLLRKVSVGIAAGVTLLASYVWWQSYDWNRQLIDDTYQGVTT
YKTITSGGLNAKSDVITLTKGLTLIRDLPVGFGTDKPEDAYTFGLYQGDKLKQPATAAYHRALETHLMPY
LQSVLSAEMDANGEHLNYLYETLKTYLMLYFPEHFDKSDVQVWFSAYIDRNIVGDVNGEVRKELNKHIDT
LLSLGVRGHQYDSMTVDSARINLTMLPLVERAYQRLKSDFSNSSIPDFKLVDILSLDSLDGLVFTSGRQF
NQGIPGLYTFNGFHGIFSIEKNKIIKNLTADSWVYGDELVDLDEQAKAQITQELENRYIRDYIFYWEDFL
SDLAIKPYSTREEAESVTAALASPDQPIKTIITAVQKNVNLTKLPADSNNLKAAAEVAGNISDVAFRSKK
ARLNRLLPDTAIELDIDLPGKDVEFAFAELLKINPADIDKIQTTLRALNRNYNKLSMQSEGQGNVVNQAT
EESFAQLGSSLSEQLMDLPYPVKNWLSEVAYRTRSFAKSNQSQRFNGIWRSQVLAEFNRAIAGRYPFDRK
SSEDVRLKDFSKFFGYGGTLDKFWDQYLASHVDTSKKPWRFKRNIGIRNDILEMYQRAEIIKEAFFEPGS
KQPIVNFSLEPELLDRSVSMFLFEIDSQQLKYRHGPTRKELFTWPGPGANNETRIAFSPPNGGRSINKKY
EGEWSFFKLLDELSKKRPQTKKDGKLLINLKGYNAVLKLTANSVNNPFWMANMEKFRCPANL
 
Nucleotide Sequence: 3549 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2829105-2825557 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGTCTTTAAAATCAATTGGCAAAGGAATTGTCGACACACTTAAGTCTAAATGGGCAATTACCATAATAG
GTTTTTTATGTTTGGCTTTACTTATTTGGTTTGGTGGTCCTTTAGTGGCTATAGCTGGGTATGAACCATT
AGCATCAGCAGCAACACGGGTTATCTTACTACTGGTTATTGTTATTATTTTTGGTGCCATTCACTTTACT
CGACAACTCAAGAATAAAAAACAAAGCGAGAAAATGGTTGATAGCTTAATTAACGGTGAAGAGGGTAACT
CTGTGACCGGTGATGACTTAGCCAAAAGTGAAATCACTGTTTTACAGAATAAAATGACCCAAGCGTTAGA
TATTCTTAAAAATACCAAGCTAACTAAAAATAAAAGTATTTACGAATTACCTTGGTACATCATGATTGGT
CCGCCAGGAAGTGGAAAAACCACCGCGATTCAGCATTCAGGTCTTGAATACCCATTAAAAGAAAAAATGG
GTGTAGATATGATTGAAGGCGTTGGCGGTACAAGACACTGTGATTGGTGGTTTACCAATAAAGCAGTATT
AATTGATACGGCGGGTCGTTATACCACTCAAGATAGTCATGTAAAACAAGACTCTCGGGCATGGCAAGGT
TTTCTGGGGTTATTGAAAAAATATCGCCCTGTTCGTCCTATTAATGGGGTGATAATCAGCATGGGTATGT
CTGATTTATTAAACCAAACCAAGACTGAGAGAAACTTACATGCGCGAGCAATTAAGCAGCGTTTACAAGA
ACTGCAAAATCAACTGGGTATGACTTTTCCGGTATATGTTTTATTTTCTAAATCAGATTTAGTTGCCGGT
TTTAATGAGTTTTTTGATGATTTAACCAAAGAAGATTGTGAACAAATTTGGGGTATTACCTTCCCATTAA
ATGCAGATACAGAAGACACTGATATTGTTAGTTCATTTAATAAAGAATTTCATGATTTATTATTAAATTT
AAATGCAAGATTAAATAGCCGCCTAAAAAACGAACGCGACCTAGAGCGTCGTGCGGCCATCTATGAGTTT
CCAAAGCAGCTTCGGTTATTACAGAGCTCAGCAGATGATTTTCTTAAAGAAATTTTTGCGCCTAATGCAT
ATGAAGAAGCACCGCTATTGCGTGGTGTTTACTTAACCAGTGCAACTCAAGAAGGTACGCCAATCGATCA
TCTTTCTAGTCACTTATCTAGTGGCATTAAGAGTAAAGCTAAAACCTTCGCCGCAAATAAACAACGCAGC
TATTTTATTAAACGCCTGTTAGAAGACGTTATTTTTCCAGAGAAAAATTTAGCATCAACCAATCGAAAGC
ATACAAACCATAATAAACTTTTACGTAAAGTATCAGTAGGCATTGCTGCAGGTGTGACCTTGCTTGCTAG
TTATGTTTGGTGGCAAAGTTATGATTGGAATAGACAATTGATTGATGATACCTATCAAGGTGTCACGACA
TACAAAACCATTACCAGTGGTGGGTTAAATGCTAAGTCAGATGTGATTACACTTACCAAAGGCTTAACAT
TAATTCGTGATCTCCCTGTTGGTTTTGGTACTGATAAACCTGAGGATGCATATACCTTTGGTTTGTATCA
AGGAGATAAGCTTAAACAACCTGCTACAGCGGCTTATCACCGTGCTTTAGAAACACATTTAATGCCTTAC
CTACAAAGTGTGCTTAGTGCAGAAATGGACGCTAATGGTGAGCACCTTAACTACCTATATGAAACATTAA
AAACCTATTTAATGTTGTATTTTCCTGAGCATTTTGACAAAAGTGATGTGCAAGTCTGGTTCTCCGCTTA
TATCGATAGAAACATTGTTGGTGATGTAAATGGTGAGGTTAGGAAAGAGCTAAATAAGCATATAGATACA
TTACTGTCTTTAGGGGTTAGAGGTCATCAATACGACAGTATGACAGTTGATAGTGCTCGGATTAATTTGA
CCATGTTACCTCTGGTTGAGCGCGCATATCAGCGTTTAAAAAGTGATTTTTCAAACAGCAGTATCCCAGA
TTTTAAACTGGTTGATATTCTGAGTTTAGACAGTTTAGATGGTTTGGTGTTCACCAGTGGTCGCCAATTT
AATCAAGGCATTCCTGGTCTTTATACTTTTAATGGTTTTCATGGCATTTTTAGTATAGAAAAGAATAAGA
TAATAAAAAACCTAACCGCAGACAGTTGGGTATATGGTGATGAGTTAGTTGATTTAGACGAACAAGCCAA
AGCGCAGATTACCCAAGAGTTAGAAAACAGATACATTCGTGATTATATTTTCTATTGGGAAGATTTCTTA
AGCGACCTTGCTATCAAACCATATTCAACACGTGAGGAAGCTGAGAGTGTTACTGCAGCACTTGCTAGCC
CAGATCAACCGATCAAAACCATTATTACCGCAGTTCAGAAAAATGTGAATTTAACTAAGCTTCCTGCCGA
TTCAAATAATTTAAAGGCCGCGGCGGAAGTGGCCGGTAATATTTCTGATGTTGCATTTCGATCTAAAAAA
GCACGATTAAATAGGCTATTACCCGATACAGCAATAGAGTTAGATATTGATTTGCCGGGCAAGGATGTGG
AATTTGCTTTTGCAGAATTGCTCAAAATCAATCCCGCTGATATTGATAAAATTCAAACGACGTTACGCGC
TCTTAATCGAAACTACAATAAATTATCAATGCAGTCAGAAGGACAAGGTAACGTTGTTAATCAAGCCACA
GAAGAAAGCTTTGCTCAACTAGGTTCTAGTTTATCTGAGCAATTGATGGATCTACCTTATCCAGTAAAAA
ATTGGTTAAGTGAAGTGGCTTATCGTACTCGCTCGTTTGCCAAATCCAATCAAAGTCAGCGTTTCAACGG
TATTTGGCGTTCGCAAGTGTTGGCCGAATTCAATCGAGCGATTGCAGGGCGTTACCCATTTGACCGAAAA
TCGTCAGAAGATGTCAGACTAAAAGACTTCAGTAAGTTTTTTGGTTATGGCGGCACCTTAGATAAATTTT
GGGATCAATACCTCGCTTCACATGTAGATACCAGCAAAAAACCTTGGCGTTTTAAGCGTAATATCGGCAT
TCGTAATGACATTTTAGAAATGTATCAACGCGCTGAAATTATTAAAGAAGCATTTTTCGAACCAGGATCT
AAGCAGCCTATTGTTAACTTTTCATTAGAACCGGAATTATTAGATAGAAGTGTGAGTATGTTTTTATTCG
AAATAGACAGCCAACAGCTGAAGTATCGACACGGTCCTACTCGCAAAGAGTTATTTACGTGGCCTGGCCC
TGGTGCAAATAACGAAACACGAATTGCATTTTCACCTCCTAACGGCGGGCGCTCTATCAATAAGAAATAT
GAGGGTGAATGGTCATTCTTCAAATTATTAGATGAATTAAGTAAAAAGCGTCCACAAACTAAAAAAGATG
GCAAGTTACTCATCAATCTCAAAGGCTACAACGCTGTACTGAAATTGACCGCAAACAGTGTTAACAATCC
ATTTTGGATGGCAAATATGGAGAAGTTTAGATGTCCTGCGAACCTTTAA
 Primer design