SecReT6
Protein ID: 114563544
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2374
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2829129..2830418 [-]
ProductOmpA/MotB domain-containing protein
NoteTssL
UniProt IDQ080U6
KEGG IDsfr:Sfri_2374
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-69, Aligned region: 52..256
OmpA [PF00691], Evalue: 1.50E-12, Aligned region: 323..421
Protein Sequence: 429 a.a.     [Download]
>gi|114563544|ref|YP_751057.1| OmpA/MotB domain-containing protein [Shewanella frigidimarina NCIMB 400]
MNDKTIVKPRPGKGSGMAANKTKVDDDSQKTLIQDHRADNRDNRSQLSLSQNPIVDFAGTLLSICTQLRN
STEHDDVNTLRVHCVELIKNYEQQLRNANLASDDIKSARYCLCCFIDEVVLNTPWGEQSYWASDSLLSTF
HNETLGGEYFYTLLEASLRHPSEKCNLLELMYLCLTLGFVGKMRVEPQGDQKLEALREKTYLAIQSCKGD
FHRELSPGWRQNIVPNLTFQQPFPLWVIGALFGVVTLFIYMGFSYSINNYSSEAYKELTSIVPWEKTIDA
QQQISRDEALLLQQLLQTEIGKNLLEVEQLSDRVRIRIGATELFASGNTQPRSDFEAILAKIALTLESTD
GKILITGHTDDEPIFTSKYPSNWHLSLARATSIANVLANSASLSGRLWPEGRGESEPRVVNDNEQNRALN
RRIEIDLLF
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2830418-2829129 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
GTGAACGATAAAACCATCGTTAAACCTCGCCCAGGGAAAGGGTCGGGTATGGCTGCCAATAAAACAAAAG
TCGATGATGATAGTCAGAAAACCTTGATCCAAGATCATCGTGCCGATAATCGCGACAACCGATCGCAACT
AAGCTTATCGCAAAACCCAATCGTTGATTTTGCGGGTACGCTTTTATCTATTTGTACTCAGTTACGAAAT
AGTACCGAGCATGATGATGTCAATACTTTACGGGTGCATTGTGTCGAACTCATCAAGAATTATGAGCAAC
AATTGCGTAATGCAAATTTAGCGTCAGATGACATTAAGTCTGCTCGATATTGCTTGTGTTGTTTTATTGA
TGAAGTAGTTCTCAATACGCCTTGGGGAGAGCAAAGCTATTGGGCATCAGACAGTTTGCTTTCTACTTTT
CATAATGAAACTTTAGGTGGTGAATATTTCTATACCTTGCTTGAAGCATCACTTCGTCATCCTTCTGAAA
AGTGTAATTTACTTGAGTTGATGTATTTATGTTTAACTCTTGGTTTTGTTGGCAAAATGAGAGTTGAGCC
TCAAGGCGATCAAAAATTAGAAGCATTACGTGAAAAAACGTATTTAGCCATTCAATCTTGCAAAGGCGAT
TTTCATAGAGAGTTATCACCAGGATGGCGACAGAATATTGTCCCTAATTTAACTTTTCAGCAGCCATTTC
CTTTATGGGTTATCGGGGCATTATTTGGTGTGGTTACTTTATTTATCTATATGGGTTTTAGTTACAGCAT
CAACAATTACTCATCAGAAGCTTATAAAGAATTGACTTCGATTGTGCCTTGGGAAAAAACCATTGATGCG
CAACAACAAATTAGTCGTGATGAAGCATTATTACTGCAACAACTATTACAAACCGAAATTGGCAAAAATT
TACTCGAAGTAGAACAATTAAGCGATCGTGTGAGGATCCGCATTGGGGCGACTGAACTTTTTGCTTCTGG
TAACACTCAACCTCGGTCTGATTTTGAAGCGATTTTAGCCAAAATAGCTCTGACGCTAGAGAGTACCGAT
GGCAAAATTTTGATCACCGGTCATACCGATGATGAACCCATTTTTACCTCTAAATATCCATCAAATTGGC
ATCTTTCATTAGCAAGAGCAACGTCGATTGCGAACGTTCTGGCTAATAGCGCATCGCTAAGTGGCCGATT
GTGGCCTGAAGGTCGTGGTGAGTCTGAGCCCCGTGTGGTGAATGACAATGAACAGAACCGCGCGTTAAAT
CGTCGAATCGAAATCGACTTATTGTTTTAG
 Primer design