SecReT6
Protein ID: 114563545
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2375
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2830443..2831771 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ080U5
KEGG IDsfr:Sfri_2375
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-148, Aligned region: 19..440
Protein Sequence: 442 a.a.     [Download]
>gi|114563545|ref|YP_751058.1| hypothetical protein Sfri_2375 [Shewanella frigidimarina NCIMB 400]
MSDFSPIAWTEGMFLRPQHMQQQERFLQHQQARTAKNNNPLAWGVVSYEVNYGLLPLGQFGLDRIDCVFP
DNTLACLPEQSPLPTAITVPAGTLDQLVYLVLPVAKSNGMNISSSEQNQITRYSYEDHNIVDTSVGSDAM
EVLQVAKLDCRLKLQSEDRSGYVSIAIARVIDVSEEGVIRLDKKFIPACIGIEHIKTLMNMTTEVTGMIN
QRAEAIAGRLSQSQGTSSSIADFLMLQLLNKYQPIFEHYGVVNHIHPELLFRTLISFSGELSTFSSPNKR
PPKFPVYQHDNLTYVFSNTMVIVNHGLSSVLEQSATELILEKTKFGVYFSTIADKSMLDNAEFILAVKAN
VPHDELRQRLPSQIKIGSVETIRELVNNQLPGIGISNLPVAPRQVPYHAGYHYFQLDKNNSHWIKLKSSG
GVAMHISGAYPELQIELWAVSI
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2831771-2830443 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGAGCGATTTTAGCCCAATAGCATGGACAGAGGGCATGTTTCTTCGTCCACAACATATGCAGCAGCAAG
AACGTTTTTTGCAACATCAACAAGCGCGAACTGCCAAGAATAACAATCCACTTGCTTGGGGGGTTGTGAG
CTATGAAGTAAATTATGGCCTACTTCCACTGGGGCAATTTGGATTAGACCGCATCGATTGTGTTTTTCCA
GATAACACCTTGGCTTGTCTTCCTGAGCAGAGTCCGTTACCAACGGCTATTACTGTCCCAGCAGGTACAT
TGGATCAACTTGTCTATCTTGTTCTTCCCGTTGCTAAAAGCAATGGGATGAATATTTCATCTTCTGAACA
AAATCAAATTACTCGTTACAGCTATGAAGATCACAACATTGTTGACACAAGCGTTGGGTCCGATGCTATG
GAAGTGCTGCAAGTTGCCAAACTAGATTGTCGGTTAAAGTTACAAAGTGAAGACCGATCAGGTTATGTTT
CAATCGCGATAGCTCGAGTTATTGATGTGTCTGAAGAGGGCGTGATTCGATTAGATAAAAAGTTTATTCC
GGCATGTATTGGCATTGAACACATCAAAACCTTAATGAATATGACAACTGAAGTCACCGGTATGATTAAT
CAGCGTGCAGAAGCTATAGCCGGTCGCTTAAGTCAATCCCAAGGGACTTCTAGTTCGATAGCAGACTTTT
TAATGTTACAACTTTTAAATAAGTACCAACCCATTTTCGAACATTATGGTGTTGTTAATCACATTCATCC
GGAATTGCTATTTCGCACACTCATTAGTTTTTCTGGCGAACTTTCAACGTTCAGCAGCCCCAACAAGCGA
CCGCCAAAATTTCCAGTCTATCAACATGACAATTTAACCTATGTATTTAGTAATACTATGGTGATTGTGA
ATCATGGTTTAAGTAGCGTATTGGAGCAAAGTGCTACAGAGCTGATCCTAGAAAAGACCAAATTTGGTGT
ATATTTCTCGACGATTGCAGATAAAAGTATGCTTGATAATGCTGAGTTTATTCTTGCTGTTAAAGCAAAT
GTTCCGCATGACGAGCTTCGCCAACGCCTACCTTCGCAAATTAAAATAGGGTCAGTTGAAACCATTCGAG
AGCTGGTAAATAACCAATTACCAGGCATTGGAATATCCAACCTACCAGTAGCACCAAGACAGGTGCCATA
CCATGCTGGTTATCACTATTTTCAATTAGATAAAAACAACAGCCATTGGATAAAGCTTAAATCAAGTGGC
GGTGTAGCGATGCATATTTCTGGTGCTTATCCAGAGTTACAAATAGAACTTTGGGCTGTGAGTATTTAA
 Primer design