SecReT6
Protein ID: 114563546
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2376
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2831796..2832266 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ080U4
KEGG IDsfr:Sfri_2376
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.00E-39, Aligned region: 17..149
Protein Sequence: 156 a.a.     [Download]
>gi|114563546|ref|YP_751059.1| hypothetical protein Sfri_2376 [Shewanella frigidimarina NCIMB 400]
MKLKLGLYQIVLVSFLLLNSGCKTINAVVPPSTDITFNASADINPDINDRPSPVVVKIFELSSRTIFDTQ
DFFTLDESAENVLGPDLIRKDELELQPSETREYAMTLGQNTRFVGVIVAYRDIDSSRWRSVVAVDPTGYD
DVVINIEKIAVYNSEK
 
Nucleotide Sequence: 471 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2832266-2831796 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGAAATTGAAGTTAGGTCTATATCAAATTGTATTAGTAAGCTTTTTATTACTTAACTCTGGCTGTAAAA
CGATTAATGCTGTCGTCCCACCATCGACAGATATTACCTTTAATGCCAGTGCTGACATTAATCCAGACAT
TAACGACCGGCCATCACCAGTGGTGGTGAAAATATTTGAATTATCATCAAGAACTATCTTTGATACTCAA
GATTTTTTTACCCTTGATGAGTCAGCAGAAAATGTGCTTGGTCCAGATCTTATCCGTAAGGATGAGCTGG
AATTACAACCATCAGAAACGCGTGAGTATGCCATGACATTGGGACAAAACACGCGATTTGTTGGTGTTAT
TGTCGCATACAGAGATATTGATTCATCTCGTTGGCGTTCTGTCGTCGCAGTCGATCCTACTGGTTATGAT
GATGTTGTTATCAATATAGAAAAAATAGCAGTTTATAACTCTGAAAAATAA
 Primer design