SecReT6
Protein ID: 114563547
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2377
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2832285..2833661 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ080U3
KEGG IDsfr:Sfri_2377
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.40E-13, Aligned region: 35..103
Protein Sequence: 458 a.a.     [Download]
>gi|114563547|ref|YP_751060.1| FHA domain-containing protein [Shewanella frigidimarina NCIMB 400]
MKEDVIEMELSLEIVSYHRLSPEQVITKDVTDTLTLGRSDVCDWHMPDPEKVVSGTHARIIKRSDDFFIE
DLSTNGLYVNRAVEALGANREHKIEHDDLFTFGDYEISAKLQMLNVTSNSHVQQDVHDAPPVATLQQNKV
IPAASSSSMLDTGFESDLAGFDSAMLLNQSRQQSAGLSQINADLQDHFQPPVAIPEEWDKDIFGQGSQAH
TQADTRSAVPQEPMPQVSQASVNLIKVPEVVKAEVKKVAPEAPNTKASVSTLVSPASALSKAFFQGLGVN
EHDYVNVLTEELMFELGQSMQFMLTGLMESLRQRSKLKTEFRINQTTFQQRENNPLKFSANIDDVFQNLF
LRKSASFLSSQQAITEAFNDGRKHDTALTAGTLGAIRGLLNQLDPEFIEAKSQNQSLTDMLVPGQKQMRQ
WKVYKSLHSNLKTEFMQDSAAALSDDFVKAYDNKIKTL
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|114561188|ref|NC_008345.1|:c2833661-2832285 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGAAGGAAGATGTAATAGAAATGGAATTATCGCTAGAGATTGTGAGTTATCACAGGTTATCCCCTGAGC
AAGTCATAACAAAAGATGTCACAGACACCTTAACGTTAGGGCGCTCTGATGTATGTGACTGGCACATGCC
TGATCCTGAAAAAGTGGTATCTGGTACTCATGCTCGGATCATTAAGCGCAGTGATGACTTTTTCATTGAG
GATTTATCAACCAATGGGTTATATGTCAATCGGGCTGTCGAAGCGTTAGGCGCCAATCGTGAACATAAAA
TTGAACACGATGATTTGTTCACTTTTGGTGATTATGAGATCAGCGCGAAGTTACAAATGTTAAATGTGAC
CTCCAATAGTCATGTTCAGCAAGATGTACATGACGCACCGCCAGTAGCGACTTTGCAGCAAAATAAAGTC
ATTCCAGCAGCTTCTTCTTCATCAATGCTTGATACTGGGTTTGAGTCCGATTTAGCAGGATTTGATTCTG
CTATGTTATTGAACCAATCTCGACAACAATCAGCAGGTCTCTCGCAGATTAACGCTGATTTACAAGACCA
TTTTCAACCACCTGTTGCCATTCCAGAAGAATGGGATAAAGATATTTTTGGGCAAGGCTCTCAAGCTCAT
ACACAAGCAGATACCCGGTCTGCTGTTCCGCAAGAGCCCATGCCTCAGGTTTCTCAAGCTTCAGTTAACC
TTATCAAAGTGCCTGAAGTTGTAAAAGCTGAGGTAAAAAAAGTGGCCCCCGAGGCACCCAATACCAAGGC
GTCAGTTAGTACTCTGGTAAGCCCAGCATCTGCATTAAGCAAAGCATTTTTCCAAGGTTTGGGAGTCAAT
GAACACGATTATGTCAATGTGTTAACTGAAGAATTGATGTTTGAACTGGGCCAAAGCATGCAGTTTATGT
TGACAGGACTGATGGAATCACTACGTCAACGTTCAAAGCTGAAGACTGAGTTTAGGATCAATCAAACGAC
ATTCCAGCAGCGTGAAAATAATCCATTGAAATTTTCGGCCAATATTGATGATGTATTTCAAAATTTATTT
TTAAGGAAAAGTGCGAGTTTCTTGTCATCTCAACAAGCTATCACCGAAGCTTTTAATGACGGTCGAAAGC
ATGATACCGCGTTAACTGCAGGCACATTAGGCGCTATCCGTGGATTGCTAAATCAATTAGATCCTGAATT
TATTGAAGCCAAAAGTCAAAATCAGTCGCTTACAGACATGTTAGTGCCGGGACAGAAACAAATGCGTCAA
TGGAAGGTATATAAAAGCTTACATTCCAATTTAAAAACAGAGTTTATGCAAGACAGTGCTGCCGCATTAT
CAGATGATTTTGTTAAAGCATACGACAATAAAATTAAAACATTATAA
 Primer design