SecReT6
Protein ID: 114563549
SecReT6 ID146
T6SS typei5
Gene symbol-
Locus tagSfri_2379
StrainShewanella frigidimarina NCIMB 400
Repliconchromosome [GenBank: NC_008345] [Browse all T6SS(s) in this replicon]
Location [Strand]2835999..2836490 [+]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDQ080U1
KEGG IDsfr:Sfri_2379
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.80E-10, Aligned region: 58..135
IL33 [PF15095], Evalue: 0.00042, Aligned region: 39..143
Protein Sequence: 163 a.a.     [Download]
>gi|114563549|ref|YP_751062.1| OmpA/MotB domain-containing protein [Shewanella frigidimarina NCIMB 400]
MKRVNLSLPVIALLTLAGCQSAPVVVSEPIKTFSISPECIEYTLQTDNEMIIGFTPVYFEVNSDKSYSKL
DTHMSCVATYLANNSDKELNVQGFTDDKGTVKYNKALAQRRADGLVEFLISLGTSNDQLISTTKVIEDNG
VKLTSSERSKTRRVNFSITNKSS
 
Nucleotide Sequence: 492 bp     [Download]
>gi|114561188|ref|NC_008345.1|:2835999-2836490 Shewanella frigidimarina NCIMB 400 chromosome, complete genome
ATGAAACGCGTCAATCTTTCATTACCTGTTATTGCGTTATTAACACTTGCGGGTTGTCAATCAGCACCTG
TCGTTGTATCTGAACCAATCAAAACATTTTCTATTTCTCCAGAGTGTATTGAATATACATTACAAACAGA
TAATGAAATGATTATTGGGTTCACACCTGTGTATTTCGAAGTTAATAGTGATAAGTCATACAGTAAGCTT
GATACTCACATGTCTTGCGTTGCGACTTACCTCGCCAATAATTCTGATAAAGAACTAAATGTTCAGGGCT
TTACAGATGACAAAGGCACAGTTAAATACAATAAAGCGTTGGCACAGCGTCGTGCTGATGGTTTAGTGGA
GTTTTTAATCTCTTTGGGCACATCTAACGACCAATTAATTTCGACTACTAAAGTTATTGAAGATAACGGT
GTAAAATTAACCAGTTCTGAGCGTTCTAAGACTCGTCGGGTTAACTTTTCCATTACGAATAAATCTTCAT
AA
 Primer design