SecReT6
Protein ID: 115350447
SecReT6 ID148
T6SS typei4b
Gene symbol-
Locus tagBamb_0393
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]439677..443618 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDQ0BIS1
KEGG IDbam:Bamb_0393
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.60E-72, Aligned region: 193..451
IcmF-related [PF06761], Evalue: 2.10E-52, Aligned region: 498..876
DUF1215 [PF06744], Evalue: 6.90E-30, Aligned region: 1009..1124
Protein Sequence: 1313 a.a.     [Download]
>gi|115350447|ref|YP_772286.1| ImcF domain-containing protein [Burkholderia ambifaria AMMD]
MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAALAFAAILVLWLGVALWRRWRVKRANQQLG
QVLEEQAETGKIAAPAAAALAPDSKTADLDVLRTRLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPA
AGKSSAVLNSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRY
RPKAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSS
DKHEYDRVWGATLPYEPDEKRDVVALFDERFEELYEGLKEISVAQLSLSRGNQLSPGQLSFPLEFSTIKP
SLRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDANALPKPHSAFSKNGFFLRD
LFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALALALGGWTWSTIGNQQLVANVQADLDNVTRLQQG
RNDLQSRLQAMDILEDRIEQLEQFRRDKPVSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFM
KDVNAHPEQLVPMTRPPESGAVQGGAVPVSTNPPGAAPPAGAAQGASAAAAAAPQQPAAPQGGLYSDASP
TNVQDAYNALKTYLMLSDKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIKSAERMISFYLSRVTDDD
WPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGDGNQGLVAGSYAIPGTF
TREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGSPEQIQKTLVGMYKTEYAQHWQKFMQGIAV
QGFSSFGQAVDGMNRLGDPQDSPIRKILETAYDQTSWDNPSLANVTIKKAQTGVVNWVKQLFTRSQAGQM
AAANIDINGNPAEVPMGPIGQEFIGLARIVATHDGTSMLKGYMDSLSKVRTRFNVIKNQGDPGPGARQLM
QQTLDGNGSELADSLKFVDEQMLTGLTDSQRKSLRPLLVRPLMQAFSVVIQPASAEVNKVWNAQVYQPFQ
SSLATKYPFAANAKVEAGAGEIAQVFGPDGAIAKFVGTTLGPLAVRRGDTLAARTWGDMGIGLTPDFTNG
FARWVAPLAGGAAGGAAAAAEPQTVFQILPQPSTGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSPG
ATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRKRRPDGTFDLTWIQGSVNVSVTMRIISTSQPTGGGGD
QPQQQSLRGLQLPSSVADASAGAAQNATQAGNGAPAAAPAVTAATATNAQGAQ
 
Nucleotide Sequence: 3942 bp     [Download]
>gi|115350056|ref|NC_008390.1|:c443618-439677 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGCTGACTCATCCGCGTACGCTCTCGATTGTCGGGATCGTCGCGCTAGCGG
CGATTCTCTTCATCGTCGCCGACATGCTGCAGCTGCCGCTCCTGTGGGCGGCGCTCGCCTTCGCGGCGAT
CCTCGTGCTGTGGCTCGGCGTCGCGTTGTGGCGCCGCTGGCGCGTGAAGCGCGCGAACCAGCAACTCGGC
CAGGTGCTGGAGGAGCAGGCGGAAACCGGCAAGATCGCCGCGCCGGCCGCGGCCGCGCTCGCGCCCGACT
CGAAGACCGCCGACCTCGACGTGCTGCGCACGCGCCTGTCCGACGCGGTGAAGACGATCAAGACGTCGAA
GATCGGCCAGGTGTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCGGCC
GCGGGCAAGAGCAGCGCCGTGCTGAACTCCGGCCTGCAGTTTCCGTTCGCGGACAAGAACAGCGCCGTGA
TCCACGGCATCGGCGGCACGCGCAACTGCGACTGGTTCTTCACGACCGAGGGGATCCTGCTCGACACGGC
CGGCCGCTACTCGGTGCACGAGGAAGACCGCAGCGAATGGCTCGGCTTCCTCGGCCTGCTGAAACGCTAC
CGTCCGAAGGCGCCGATCAACGGCATCATCGTCACCGCGAGCATCGCCGAACTCACCGGCAACCGCCCCG
AATTTGCGATCAACCTCGCGAAAAACCTCCGTCAGCGCGTTCAGGAGCTGACCGAAAAGCTCGAGGTGTT
CGCGCCGGTCTACGTGATGTTCACGAAGGCCGACCTGATCACCGGCTTCACCGAATTCTTCAGCAGCAGC
GACAAGCACGAGTACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAGCCGGACGAGAAGCGCGACGTCG
TCGCGCTGTTCGACGAGCGCTTCGAGGAGCTGTACGAAGGGCTGAAGGAGATCAGCGTCGCGCAGCTGTC
GCTGTCGCGCGGCAACCAGCTGTCGCCGGGCCAGTTGAGCTTCCCGCTCGAATTTTCGACGATCAAGCCG
TCGCTGCGCGCGTTCCTCGCGACGCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCT
TCTACTTCACCAGCGCGCTGCAGGAAGGCGAAACCAACAGCGCCGCCGCGCAGCGCATCGCGCACCGCTT
CGGCCTCGACGCGAACGCGCTGCCGAAGCCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGAC
CTGTTCTCCAAGGTGATCTTCGCGGACCGCCAGACCGTGCGCCAGTTCGCGAGCCCGACCAAGACCCGGC
TGCGCTACGCGACCTTCTTCGGCTTCGTCGCGGCCCTCGCGCTCGCCCTCGGCGGCTGGACCTGGTCGAC
GATCGGCAACCAGCAGCTCGTCGCGAACGTACAGGCCGACCTCGACAACGTCACGCGCCTTCAGCAGGGC
CGCAATGACCTGCAGTCGCGCCTGCAGGCGATGGACATCCTGGAAGACCGGATCGAACAGCTCGAGCAGT
TCCGCCGCGACAAGCCGGTGTCGGTGTCGCTCGGCCTGTACCAGGGCGACCGTCTCGAGCAGCATCTGCT
GACCGAGTACTACAACGGCGTGCGCCAGATCCTGCTCGCGCCGGTCTCGCAGAACCTGGCGTCGTTCATG
AAGGACGTGAACGCGCACCCCGAACAGCTCGTGCCGATGACGCGCCCGCCCGAATCGGGTGCCGTGCAGG
GCGGCGCGGTGCCGGTCTCGACCAACCCGCCGGGCGCCGCACCGCCGGCCGGCGCCGCGCAAGGCGCATC
CGCCGCAGCGGCCGCCGCGCCGCAACAGCCGGCTGCGCCGCAGGGCGGGCTGTACAGCGACGCGTCGCCG
ACCAACGTGCAGGACGCGTACAACGCGCTGAAGACCTACCTGATGCTGTCCGACAAGCGTCATGTCGAAC
AGGCGCACCTGACCGACCAGCTCGCCCGCTTCTGGCGCGGCTGGCTCGAGACGAATCGCGGCAACATGCC
GCGCGACGAGATGATCAAGAGCGCCGAGCGCATGATCTCGTTCTATCTATCGCGCGTGACCGACGACGAC
TGGCCGATGATCGACGCGAACCTCGCGCTCGTCGATCAGACTCGCGAGAACCTGCGCCGCGTCGTGCGCG
GCATGCCGGCCCGCCAGCGCGTCTACGAGGAAATCAAGGCCCGCGCGTCGACCCGCTTCGCGCCGATGAC
CATCGCGCGCATCGTCGGCGACGGTAACCAGGGGCTGGTCGCCGGCAGCTACGCGATTCCGGGCACGTTC
ACGCGTGAAGCCTGGTTCGACTACGTGCAGCCGGCGATCCGCGACGCGGCGACCAAGGAGCTGCAGGCGA
AGGACTGGGTGCTGAACACGTCGACGCAGGACGACCTGACGCTCGAAGGCAGCCCCGAGCAGATCCAGAA
GACCCTCGTCGGGATGTACAAGACCGAATACGCACAGCACTGGCAGAAGTTCATGCAGGGCATCGCGGTG
CAGGGCTTCAGCAGCTTCGGCCAGGCCGTCGACGGGATGAACCGCCTCGGCGATCCGCAGGATTCGCCGA
TCCGCAAGATCCTCGAGACCGCGTACGACCAGACGTCGTGGGACAACCCGTCGCTCGCAAACGTGACGAT
CAAGAAGGCGCAGACGGGTGTCGTGAACTGGGTCAAGCAACTGTTCACGCGCTCGCAGGCCGGCCAGATG
GCGGCCGCGAACATCGACATCAACGGCAATCCGGCCGAGGTGCCGATGGGTCCGATCGGCCAGGAGTTCA
TCGGGCTCGCGCGGATCGTCGCGACGCACGACGGCACGTCGATGCTCAAGGGCTACATGGATTCGCTGTC
GAAGGTGCGCACGCGCTTCAACGTGATCAAGAACCAGGGCGACCCCGGCCCCGGCGCGCGCCAGCTGATG
CAGCAGACGCTCGACGGCAACGGCTCGGAACTCGCCGATTCGCTGAAGTTCGTCGACGAGCAGATGCTGA
CCGGCCTCACCGATTCGCAACGCAAGTCGCTGCGTCCGCTGCTGGTGCGCCCGCTGATGCAGGCGTTCTC
GGTGGTGATTCAGCCGGCCAGCGCCGAAGTCAACAAGGTGTGGAACGCGCAGGTCTACCAGCCGTTCCAG
AGCTCGCTCGCGACGAAGTACCCGTTCGCCGCGAATGCGAAGGTCGAGGCCGGCGCAGGCGAAATCGCGC
AGGTGTTCGGCCCGGACGGTGCGATCGCCAAGTTCGTCGGCACGACGCTGGGCCCGCTCGCGGTGCGCCG
CGGCGACACGCTCGCGGCCCGCACGTGGGGCGACATGGGCATCGGCCTCACGCCTGACTTCACGAACGGC
TTCGCGCGCTGGGTCGCCCCGCTCGCCGGCGGCGCCGCAGGTGGCGCGGCCGCGGCGGCCGAACCGCAGA
CCGTGTTCCAGATCCTGCCGCAGCCGAGCACGGGCACGACGGAATACACGATCGCGATCGACGGCCAGCA
ACTGCGCTACCGCAACACGCCGCCGCAGTGGACCAATTTCGTGTGGCCGAACCCGCAGGGGTCGCCGGGC
GCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGGTGCAGCTCGTCAACGAGCCGGGCCGCTACGGTC
TCGAGAAGCTGATCAACTCCGCGCAGCGCAAGCGCCGTCCGGACGGCACCTTCGATCTCACGTGGATCCA
GGGCAGCGTGAACGTGTCGGTGACGATGCGTATCATCAGCACGTCGCAGCCGACGGGCGGCGGCGGCGAC
CAGCCGCAGCAGCAGAGCCTGCGCGGCCTGCAGCTGCCGTCGTCGGTCGCCGACGCGAGCGCGGGCGCGG
CACAGAACGCGACGCAGGCCGGCAACGGCGCGCCGGCCGCGGCACCGGCCGTCACGGCCGCCACCGCAAC
GAATGCACAGGGGGCGCAATGA
 Primer design