SecReT6
Protein ID: 115358235
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3485
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]287424..291521 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDQ0B9Y4
KEGG IDbam:Bamb_3485
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.50E-98, Aligned region: 111..173
IcmF-related [PF06761], Evalue: 2.50E-98, Aligned region: 641..961
ImcF-related_N [PF14331], Evalue: 4.20E-93, Aligned region: 324..594
DUF1215 [PF06744], Evalue: 4.40E-34, Aligned region: 957..986
DUF1215 [PF06744], Evalue: 4.40E-34, Aligned region: 1071..1194
Protein Sequence: 1365 a.a.     [Download]
>gi|115358235|ref|YP_775373.1| ImcF domain-containing protein [Burkholderia ambifaria AMMD]
MKKFQFLSFLASRQFLAFLALIVVALVIWFVGPLFAFGGLKPLAGAGMRVLLIALLLAGVLLWLAGLSTS
VVFVVLLCLLIWYAAPLLSLGHTAPFEPVSARLTAIALVVAAFVLFWIVRLWQKMREDDAFMKKMLRMDR
RENESPAAPRLRKIEAVVTSALARLKSMRTGARGLGKLFQGKRYLYELPWYITLGSQGAGKTSVLMNGGL
VFPVAEQMQRAAGPSAGDAAAVDWWLTNDAVLIDTAGYYTHHGMSTAEDVKAPAAETGKPATGVPGKGGA
DAQPAAKSAEDDTKRNEASQSKAAAVSTAGGPVVPPDQGAGERRQKVDRAEWLGFLGMLRRHRPRAPING
ALLTIDLATLAGGDEQARVAEAATLRARLAELRQELGIRFPVYVMVTKMDRLTGFAEYFGGLTAEGRAQT
WGFTLPYGKETVAKERLRARCQAELAELSQRLSGSIDTHLQDEYDTRKRRSLAALPEEFAALLGPLLDLI
DRVFLDSRYDDTQLHSTLRGVYFTSARQRDSEIVVERGTVVQRLLSTQDHAPVSSARAEGNQGFFLHDLL
TRVVFPEAHLVSPNLRWEYRYRLLRLIGHTLALLLFVWLAIGLRVSFGHNGDYLATIGRKVQALTARVTE
LYKTPKLQAVPDTLTDARYLPTFPGLDLSDPDSAWRYGLYTPVDIATESHRTYDALEDNLLLPQIVHRLE
DVMSGAIANKDPKAAYDALRVYLMLYDKAKFNAADVKAWVLDDWAKTDSAAAFGGRASMIDHVQQLFSGA
RVVQSPVIRNDALVQQARAFLEGSNATDRLYQRAKAAMLKEAPDEFTLLRAVGPQAGTVFTRASDAPLSR
GVSGLFTFDGYRNLFDKRLPEFVQIARDDDAWVMGRSYLGEAQKKTAEIVSNAAGADDALTDAVRREYLM
EYAQQWDAFLNDIRTVSGTSLAFNLKVLRSFAAPDSPLVRLARAAVHETTLAQPMTVTDGSLLQRAADQI
NQKTDKALGIRASERVERELVDNHFAALREVVTGSVDAQSDTQPAATQADKTGLDGVTSLLNDYYTALTV
ADNALSNNSMPPASDVAAKLKMTADTMPAPFRAVLLQLAADGSREVNQGIGQLLSRQMQAVVGDACRLTI
EGNYPFSPDSKRDVGIDDFTRVFAQGGVIDDFFVKTLAPFVDTSAKPWRYRTLPGATEPVQGPDLEPFEH
AKAIRDIFFNDPGHKQLTWKADIRIPELDPTIMSLSLDIDGQTTLYQHGPVAPFTVTWPGPRGGVHTEIT
ASPRIRPDTSTISTDGPWALMRLLEKGRVMETATPGRTRVAFSFDGRQAALDVASAGSVANPLTSDVLKT
FRCPSTMSAFNLPDSGPPPGLPRGMLPASAGSASR
 
Nucleotide Sequence: 4098 bp     [Download]
>gi|115357970|ref|NC_008391.1|:287424-291521 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGAAGAAGTTCCAGTTCCTGTCGTTTCTGGCCTCGCGCCAGTTCCTCGCGTTCCTCGCACTGATCGTCG
TTGCATTGGTGATCTGGTTCGTCGGGCCGCTTTTCGCGTTCGGCGGGCTCAAGCCGCTCGCCGGCGCTGG
CATGCGCGTGCTGCTGATCGCGCTGTTGCTCGCCGGTGTGCTGCTCTGGCTCGCGGGCTTGTCGACGAGC
GTCGTGTTCGTCGTGTTGCTGTGCCTGCTGATCTGGTATGCGGCGCCGCTGCTGTCGCTCGGCCACACGG
CGCCGTTCGAGCCCGTGTCGGCCCGACTCACCGCGATCGCACTGGTCGTGGCCGCTTTTGTCCTCTTCTG
GATCGTCCGCCTGTGGCAAAAAATGCGTGAAGACGACGCGTTCATGAAGAAGATGCTGCGCATGGATCGC
CGCGAGAATGAATCGCCTGCCGCACCACGCTTGCGGAAAATCGAAGCGGTCGTGACGAGCGCGCTCGCGC
GCCTCAAATCGATGCGTACCGGCGCGCGCGGTCTTGGCAAGCTGTTCCAGGGCAAGCGGTATTTGTACGA
GTTGCCTTGGTACATCACGCTCGGCTCGCAAGGGGCCGGCAAGACCAGCGTACTGATGAACGGCGGATTG
GTGTTTCCCGTCGCCGAGCAGATGCAGCGCGCGGCCGGGCCATCGGCCGGCGACGCTGCCGCGGTGGACT
GGTGGCTGACCAACGACGCGGTGCTGATCGACACGGCCGGCTACTACACGCATCATGGCATGTCGACGGC
CGAGGACGTCAAGGCGCCCGCCGCGGAAACGGGAAAGCCGGCCACCGGCGTTCCGGGCAAGGGCGGCGCC
GATGCCCAGCCGGCTGCGAAAAGCGCTGAAGACGATACGAAGCGGAATGAGGCGTCGCAATCGAAAGCCG
CCGCCGTGTCGACAGCCGGCGGCCCAGTCGTTCCGCCCGATCAAGGTGCGGGCGAACGCCGACAGAAGGT
CGATCGCGCGGAATGGCTTGGATTTCTGGGCATGCTGCGCCGGCATCGGCCTCGCGCGCCGATCAACGGC
GCGTTGCTGACGATCGATCTTGCCACGTTGGCCGGTGGCGACGAACAGGCGCGTGTGGCTGAGGCTGCCA
CGTTGCGCGCGCGGCTGGCCGAACTGAGGCAGGAGCTGGGTATTCGTTTCCCTGTCTATGTAATGGTCAC
GAAGATGGACCGTCTGACGGGTTTCGCCGAGTATTTCGGGGGGCTGACGGCCGAGGGGAGGGCGCAGACA
TGGGGCTTCACGCTTCCGTATGGCAAGGAAACGGTTGCGAAGGAACGGCTGCGCGCCCGCTGCCAAGCGG
AACTTGCCGAACTCTCGCAACGGCTTAGCGGTTCGATCGATACGCATCTGCAGGATGAGTACGATACGCG
CAAGCGCCGGTCGCTTGCGGCGCTGCCCGAGGAGTTTGCTGCGCTGCTCGGACCGCTGCTCGATCTGATC
GACCGGGTGTTTCTCGATTCGCGCTACGACGATACCCAGCTCCATTCGACGTTGCGCGGCGTGTATTTCA
CGAGTGCACGACAACGGGACAGCGAGATCGTCGTGGAGCGCGGGACAGTCGTTCAACGTCTTCTGTCGAC
TCAGGACCACGCCCCCGTTTCATCGGCGCGAGCCGAGGGCAACCAAGGGTTCTTCCTGCACGATCTGCTG
ACCCGTGTCGTGTTCCCGGAAGCGCATCTGGTGAGCCCCAACCTGCGTTGGGAATACCGCTACCGGCTCT
TGCGCCTGATCGGCCACACATTGGCGCTGCTGTTGTTCGTGTGGCTGGCGATCGGCTTGCGCGTGAGCTT
CGGCCACAACGGCGACTATCTCGCCACGATTGGCCGAAAGGTACAGGCGCTTACGGCCCGCGTCACGGAG
TTGTACAAGACGCCGAAACTGCAAGCCGTGCCCGATACGCTGACAGACGCGCGTTATTTGCCGACCTTCC
CGGGACTCGACCTGTCCGATCCGGACAGCGCGTGGCGCTACGGTCTCTACACGCCGGTGGACATTGCAAC
CGAAAGCCACCGCACCTACGATGCGCTCGAAGATAACCTGCTGTTGCCGCAGATCGTGCATCGTTTGGAA
GACGTCATGTCAGGTGCAATTGCCAACAAGGATCCAAAGGCGGCCTACGATGCGCTGCGCGTATACCTGA
TGCTGTACGACAAGGCGAAGTTCAATGCCGCCGACGTCAAGGCGTGGGTGCTCGACGACTGGGCGAAGAC
CGATAGCGCGGCTGCTTTCGGTGGAAGGGCGTCGATGATCGACCACGTGCAACAGCTTTTCTCCGGAGCG
CGCGTGGTGCAGTCTCCGGTGATCCGCAACGACGCGCTGGTGCAGCAGGCGCGCGCTTTTCTCGAGGGTA
GCAACGCCACCGACCGCCTTTACCAGCGCGCAAAGGCGGCCATGCTGAAGGAAGCGCCCGACGAGTTTAC
GTTGCTGCGCGCGGTAGGCCCGCAAGCCGGCACGGTATTCACGCGAGCAAGCGATGCACCGTTGTCGCGC
GGCGTGTCGGGGCTTTTCACGTTCGATGGCTATCGGAATCTGTTCGACAAACGGCTGCCCGAGTTCGTGC
AGATCGCGCGCGACGACGACGCATGGGTGATGGGACGCTCATACTTGGGCGAGGCTCAAAAAAAAACGGC
TGAGATCGTGAGCAACGCCGCCGGCGCGGACGATGCGTTGACCGACGCGGTTCGCCGCGAATATCTGATG
GAATATGCCCAGCAGTGGGACGCGTTTCTCAACGACATCCGGACCGTAAGCGGCACGAGCCTTGCGTTCA
ATCTGAAGGTGCTGCGCAGCTTCGCGGCACCTGATTCGCCGCTCGTGCGGCTTGCCCGCGCAGCCGTGCA
CGAGACGACGCTCGCGCAGCCGATGACGGTGACGGACGGTTCGCTGCTGCAGCGGGCCGCCGACCAGATC
AATCAGAAGACGGACAAGGCGCTGGGTATTCGGGCGTCGGAGCGCGTTGAACGGGAACTCGTCGACAATC
ACTTTGCGGCGCTGCGCGAGGTCGTTACCGGGAGCGTGGATGCGCAATCCGATACGCAACCTGCTGCCAC
ACAGGCGGACAAGACGGGGCTGGATGGCGTTACCAGCTTGCTGAACGACTATTACACGGCGCTCACCGTT
GCCGACAATGCGTTATCGAACAACAGCATGCCGCCGGCGAGCGACGTAGCTGCGAAACTGAAAATGACGG
CCGACACGATGCCGGCACCCTTTCGCGCCGTATTGCTGCAGCTTGCCGCCGATGGTTCGCGAGAAGTCAA
TCAGGGGATCGGCCAACTGCTGTCGCGCCAGATGCAGGCGGTGGTCGGCGACGCTTGCCGGCTGACGATC
GAAGGAAATTACCCGTTTTCGCCCGACAGCAAGCGCGACGTCGGTATCGACGACTTCACGCGCGTGTTTG
CGCAGGGCGGCGTGATCGATGACTTCTTCGTGAAGACGCTGGCACCGTTCGTCGATACGTCCGCGAAGCC
GTGGCGCTATCGGACGCTGCCAGGCGCGACCGAGCCCGTCCAGGGGCCGGATCTGGAGCCGTTCGAGCAT
GCGAAGGCAATCCGCGACATCTTTTTCAACGATCCCGGCCACAAGCAACTGACCTGGAAGGCGGACATCC
GAATTCCCGAACTCGACCCGACGATCATGAGTCTGTCGCTCGACATCGATGGACAGACTACGCTCTATCA
ACATGGCCCGGTGGCGCCTTTCACGGTCACGTGGCCGGGACCGCGTGGCGGCGTCCACACGGAAATCACG
GCCAGCCCGCGCATCCGGCCGGACACGTCGACGATTTCAACCGATGGCCCTTGGGCGTTGATGCGCCTGC
TCGAGAAAGGTCGCGTGATGGAGACGGCGACGCCGGGCCGCACGCGCGTCGCGTTCAGTTTCGACGGTCG
TCAAGCGGCGCTCGACGTCGCGAGCGCCGGGAGTGTCGCGAATCCGCTGACGAGCGACGTGCTGAAGACG
TTCCGGTGCCCCAGCACGATGTCGGCGTTCAACCTGCCGGATAGCGGCCCGCCGCCGGGGTTGCCGCGAG
GCATGTTGCCGGCGAGCGCGGGAAGCGCTTCCCGCTGA
 Primer design