SecReT6
Protein ID: 116049618
SecReT6 ID152
T6SS typei1
Gene symbol-
Locus tagPA14_42900
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3812214..3815741 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ02KF9
KEGG IDpau:PA14_42900
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.30E-76, Aligned region: 255..273
IcmF-related [PF06761], Evalue: 1.30E-76, Aligned region: 502..792
IcmF-related [PF06761], Evalue: 1.30E-76, Aligned region: 948..996
ImcF-related_N [PF14331], Evalue: 7.00E-75, Aligned region: 196..453
DUF1215 [PF06744], Evalue: 4.20E-34, Aligned region: 910..1034
Protein Sequence: 1175 a.a.     [Download]
>gi|116049618|ref|YP_791577.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MKNFFKKVGAFLRKTWVWTLLLVLLAALLVWFVGPLLAVADYKFWESPTSRLLSISLMFLVWGLAMVFVS
WRAGVRRKAVEDSDEGQERLRRDGLIEDEQKELRSRFKDALRTLKTSSLYRGRSERWRNELPWYLLIGPQ
GSGKTSLLDFSGLEFPINRIDRKLTRDTAGTRYCDWYFADHGVLIDTAGRYLTQADGEVDGGAWATLLGL
LRKRRRARPLNGVMVSIPVETLLSDDEMALDTLARQVRARLQEIQQTLHLDLPVYLVLSKADQLLGFDEF
FDQLSREESDQVLGTSFGKEQNGTDVTVLRQAFEDLLRRLNSQVIMRIHQERDTLRRGRILDFPHQLGQI
GERLCLFVELAFTGNRYQRASRLRGFYLTSAPHLAQQLDEDTAGIGANLGIASGLLPTLRNGRSRFIHHL
LSQVIFPEANLAGLDRRERTRIHWGQRALYVGSLALLLLFGLLWAGGFSANHERLERVRELAQQWAQQRQ
ALGERDDAMAALKTLDSSYAATTVFPPKGEVSLHERAGLYQGNEVNPPLTAAYRRELETQLLPRVARMLE
AQIRGNMQNRERLLNSLRAYLMLNLRERRENGWLKDWVATDWSQRYAGNGTVQNGLNTHFARLLEQPFSY
PLNDTLVAQARQVLRSESLANVVYRVLREQARSLPEYRFGQHLGPQAGLFVGTDYVIPGFYTQQGYQQYF
VVQGASLVNDILRDNWVLGEGSGISDMDLRRLMVELEQLYFRDYANFWSEAVGRLGLLPFNDAGEGADQV
SGLLAANSPILQLLLEVRENTRFPVLAESAEALAEASDKAAEKGGKLGKAAAAAAGKARDALAKNLPDTA
KKSLQRRFEPLHRLLDDNNGPAADLTPLLQALNELQLQLAGLARASQPEQAAFDMAKSRMGGQRDALSNL
RNASARLPRPLGGWFSVLAEDAWRLVLGDAYLYLNQRYQSELYGFYSKAINKRYPFNAHSASDVAVSDFR
EFFKAQGVAERFFETYMRPFVSGDPGSYRLRSVDGYSLPMSKVYLDQMGTAQVIRQSFFAENPAEPQVRF
RLEPYTLDPGVSRAEFRFDGQSMEYRHGPIVPMSFKWPSDADGGRTSLVLEKMAGRPVGIERNTGPWSLF
RLFDLMQTEYLSGRDVMVLKADLGGLRANYLLLAQRTPNPFDLAVLRSFRMPVQL
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3815741-3812214 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAAAAACTTCTTCAAGAAAGTCGGCGCCTTCCTGCGCAAGACGTGGGTCTGGACGCTGCTGCTGGTAC
TCCTGGCGGCATTGCTGGTGTGGTTCGTCGGGCCGCTGCTGGCGGTCGCCGACTACAAGTTCTGGGAAAG
CCCGACCTCGCGGTTGCTGAGCATCAGTCTGATGTTCCTGGTCTGGGGGCTGGCGATGGTCTTCGTCAGC
TGGCGCGCCGGAGTGCGGCGCAAGGCCGTCGAGGACAGCGACGAGGGCCAGGAGCGCCTGCGCCGTGACG
GTCTGATCGAAGACGAACAGAAGGAATTGCGCAGCCGCTTCAAGGACGCCTTGCGCACCCTGAAGACCTC
CAGCCTGTACCGCGGTCGTAGCGAGCGCTGGCGCAACGAGCTGCCCTGGTACCTGCTGATCGGCCCGCAG
GGAAGCGGCAAGACCAGCCTGCTGGACTTTTCCGGACTGGAGTTCCCGATCAACCGGATCGACCGCAAGC
TGACCCGCGATACCGCCGGCACGCGCTACTGCGACTGGTACTTCGCCGACCACGGCGTCCTGATCGACAC
CGCCGGGCGCTACCTGACCCAAGCCGACGGCGAGGTCGACGGGGGCGCCTGGGCGACCCTGCTCGGCCTG
TTGCGCAAGCGCCGCCGCGCACGGCCGCTGAATGGCGTGATGGTGTCGATTCCGGTGGAAACGTTGCTCA
GCGACGACGAGATGGCGCTGGATACGCTGGCTCGCCAGGTGCGCGCGCGCCTGCAGGAAATCCAGCAGAC
CCTGCACCTCGATCTGCCGGTCTACCTGGTGCTGAGCAAGGCCGACCAGTTGCTCGGCTTCGACGAGTTC
TTCGACCAGTTGAGCCGCGAGGAGAGCGACCAGGTTCTGGGCACCAGCTTCGGCAAGGAGCAGAACGGCA
CCGATGTGACGGTCCTGCGCCAGGCGTTCGAGGACCTTCTGCGACGCCTGAACAGCCAGGTGATCATGCG
CATCCACCAGGAGCGCGATACTCTGCGTCGCGGTCGCATCCTCGACTTCCCGCACCAGCTTGGCCAGATC
GGCGAGCGGTTGTGCCTGTTCGTCGAACTCGCCTTCACCGGCAATCGCTACCAGCGCGCCAGCCGCCTGC
GCGGCTTCTACCTGACCAGCGCGCCGCACCTGGCCCAGCAGCTGGATGAGGACACCGCCGGCATCGGCGC
CAACCTGGGGATCGCCAGCGGCCTGCTGCCGACCCTGCGCAACGGGCGCTCGCGCTTCATCCATCACCTG
CTGAGCCAGGTGATCTTCCCCGAGGCCAACCTGGCAGGTCTCGATCGCCGCGAGCGCACGCGCATCCACT
GGGGCCAGCGCGCCCTGTACGTCGGTTCGCTGGCGCTCCTTCTGCTATTCGGCCTGCTCTGGGCTGGCGG
TTTCTCGGCCAACCACGAGCGCCTGGAGCGGGTCCGCGAGCTGGCGCAGCAATGGGCCCAGCAGCGCCAG
GCGCTTGGCGAGCGCGACGACGCCATGGCGGCGCTGAAGACGCTGGATAGCAGCTATGCGGCGACCACCG
TGTTTCCGCCCAAAGGCGAAGTCTCGCTGCACGAGCGCGCCGGGCTGTACCAGGGCAACGAGGTCAACCC
GCCGCTGACCGCTGCCTATCGCCGCGAGCTGGAGACGCAACTGCTGCCGCGCGTGGCGCGGATGCTCGAA
GCGCAGATCCGCGGCAACATGCAGAATCGCGAACGCCTGCTCAACAGCCTGCGGGCCTACCTGATGCTGA
ATCTGCGCGAGCGCCGCGAGAACGGATGGCTCAAGGACTGGGTGGCTACCGACTGGTCGCAGCGCTATGC
CGGCAACGGCACCGTGCAGAATGGCCTGAACACGCATTTCGCCCGTCTGCTCGAGCAACCGTTCAGCTAT
CCGCTGAACGACACCCTGGTGGCCCAGGCACGCCAGGTGCTGCGCAGCGAGTCCCTGGCCAACGTGGTCT
ACCGGGTGCTGCGCGAACAGGCGCGAAGCCTGCCCGAGTATCGCTTCGGCCAGCACCTGGGGCCGCAGGC
CGGTCTGTTCGTCGGCACCGACTACGTGATCCCGGGGTTCTACACCCAGCAGGGCTACCAGCAGTACTTC
GTGGTCCAGGGCGCCAGCCTGGTCAACGACATCCTTCGCGACAACTGGGTCCTGGGCGAGGGCAGCGGGA
TCAGCGACATGGACCTGCGGCGCCTGATGGTCGAACTCGAGCAGTTGTATTTCCGCGACTACGCGAACTT
CTGGAGCGAGGCGGTCGGACGCCTGGGCCTGCTGCCGTTCAACGATGCCGGCGAGGGCGCCGACCAGGTT
TCCGGGCTGCTCGCCGCCAACTCGCCGATCCTCCAGTTGTTGCTGGAGGTCCGTGAGAACACCCGTTTCC
CGGTCCTGGCGGAGAGCGCCGAGGCGCTGGCAGAGGCCAGCGACAAGGCCGCGGAAAAGGGCGGCAAGCT
GGGCAAGGCGGCCGCCGCGGCGGCCGGCAAGGCCAGGGACGCGTTGGCGAAGAACCTGCCGGATACCGCG
AAGAAGTCCCTGCAACGCCGCTTCGAGCCCCTGCATCGCCTGCTCGACGATAACAACGGCCCGGCGGCCG
ACCTCACCCCGCTGTTGCAGGCGCTCAACGAGTTGCAGTTGCAACTCGCCGGACTGGCGCGCGCCAGCCA
GCCGGAGCAGGCGGCTTTCGACATGGCGAAGAGCCGCATGGGCGGCCAGCGCGATGCCCTGAGCAACCTG
CGCAACGCCTCCGCGCGACTGCCGCGACCGCTCGGCGGATGGTTCAGCGTGCTGGCCGAAGACGCCTGGC
GGCTGGTCCTCGGCGATGCCTACCTGTACCTCAACCAGCGCTACCAGAGCGAGCTGTACGGTTTCTACAG
CAAGGCGATCAACAAGCGCTACCCGTTCAACGCGCACAGCGCCAGCGATGTCGCGGTCAGCGATTTCCGC
GAGTTCTTCAAGGCGCAGGGCGTCGCCGAACGCTTCTTCGAAACCTACATGCGGCCCTTCGTCAGCGGCG
ACCCGGGCAGCTACCGCCTGCGCAGCGTGGACGGCTACAGCCTGCCGATGTCCAAGGTCTATCTCGACCA
GATGGGCACGGCCCAGGTGATTCGCCAGAGCTTCTTCGCCGAGAACCCGGCCGAGCCGCAGGTGCGCTTC
CGTCTGGAGCCCTATACCCTCGATCCTGGCGTCAGCCGCGCCGAGTTCCGTTTCGACGGTCAATCCATGG
AATACCGCCACGGCCCGATCGTGCCGATGTCGTTCAAGTGGCCCAGCGACGCCGACGGCGGCCGCACCAG
CCTGGTGCTGGAGAAGATGGCCGGGCGACCGGTGGGAATCGAACGCAATACCGGGCCCTGGTCGCTGTTC
AGGCTGTTCGACCTGATGCAGACCGAGTACCTCAGCGGGCGTGACGTGATGGTGCTCAAGGCCGACCTGG
GCGGCCTGCGCGCCAACTACCTGCTGCTCGCCCAGCGCACGCCGAATCCGTTCGATCTCGCGGTCCTGCG
CAGCTTCCGCATGCCGGTGCAGCTCTGA
 Primer design