SecReT6
Protein ID: 116049619
SecReT6 ID152
T6SS typei1
Gene symbolstp1
Locus tagPA14_42890
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3811486..3812214 [-]
Productserine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDQ02KG0
KEGG IDpau:PA14_42890
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.40E-16, Aligned region: 19..204
PP2C [PF00481], Evalue: 1.80E-15, Aligned region: 31..234
SpoIIE [PF07228], Evalue: 2.60E-11, Aligned region: 34..241
Protein Sequence: 242 a.a.     [Download]
>gi|116049619|ref|YP_791576.1| stp1 gene product [Pseudomonas aeruginosa UCBPP-PA14]
MQRTEPWRSAARTDRGKVRARNEDAFLDCPDRGLWVVADGMGGHQAGDLASRMIVTSLAELPARAGFDER
LNAMRQCLHWLNRRLGEELTLSAERGDRIIGSTVVALVVEGSRAACVWVGDSRCYLWRGQRLYQLSRDHS
LLQRLVDERRMDIEQARAYPSARALTRAVGASEQLVLDVLELEVHPGDVFLLCSDGLYEELSADALGRAL
SLASPQVAVERLFDGALSGAARDNLTAVVIRQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3812214-3811486 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCAACGCACCGAGCCCTGGCGCAGCGCGGCGCGCACGGATCGCGGCAAGGTCCGCGCGCGCAACGAGG
ATGCCTTCCTGGACTGCCCGGATCGCGGGCTCTGGGTGGTCGCCGATGGCATGGGCGGGCACCAGGCCGG
CGACCTGGCCAGCCGGATGATCGTCACCAGCCTGGCGGAACTGCCGGCCCGGGCGGGATTCGACGAGCGC
CTGAACGCGATGCGCCAGTGCCTGCACTGGCTCAACCGGCGCCTGGGCGAGGAACTCACCCTCAGCGCCG
AACGCGGCGACAGGATCATCGGCAGTACGGTGGTGGCGCTGGTCGTGGAGGGTTCGCGGGCGGCCTGCGT
GTGGGTCGGCGACAGCCGCTGCTACCTGTGGCGCGGCCAGCGGCTGTACCAGCTGTCCCGCGACCACTCG
CTGTTGCAGCGACTGGTCGACGAACGGCGGATGGATATCGAGCAGGCGCGCGCCTATCCCTCGGCGCGCG
CGCTGACCCGTGCCGTCGGCGCCAGCGAACAACTGGTGCTGGACGTGTTGGAACTGGAGGTGCATCCCGG
TGATGTCTTCCTGCTCTGCAGCGACGGGCTCTACGAAGAGCTGAGCGCCGATGCGCTGGGCCGCGCGTTG
AGCCTGGCATCGCCGCAGGTGGCGGTGGAGCGGCTGTTCGACGGCGCCCTGAGCGGCGCCGCGCGGGACA
ACCTGACGGCCGTGGTGATCCGTCAATGA
 Primer design