SecReT6
Protein ID: 116049620
SecReT6 ID152
T6SS typei1
Gene symbolstk1
Locus tagPA14_42880
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3810500..3811489 [-]
Productserine-threonine kinase Stk1
NoteStk1
UniProt IDQ02KG1
KEGG IDpau:PA14_42880
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 4.80E-41, Aligned region: 51..286
Pkinase_Tyr [PF07714], Evalue: 1.20E-25, Aligned region: 53..306
APH [PF01636], Evalue: 4.40E-05, Aligned region: 97..176
APH [PF01636], Evalue: 4.40E-05, Aligned region: 171..203
APH [PF01636], Evalue: 4.40E-05, Aligned region: 228..305
RIO1 [PF01163], Evalue: 0.0058, Aligned region: 129..202
Protein Sequence: 329 a.a.     [Download]
>gi|116049620|ref|YP_791575.1| stk1 gene product [Pseudomonas aeruginosa UCBPP-PA14]
MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAGGMGTVYRARD
LLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRLFTFDVDTVCQRAYIVMELMP
GLPLDRLLCERPEGLPWSELSAIARPLLDALAYVHEQGVLHGDLKPSNVMLGEEGVRLFDFGLGQAQAGI
LDGLPQLSRGRIDAWTPGYAAPELLEGAPLSPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQL
RAPGHLPRRCWPALRTALSLDPERRCIGVRELQEALGARRSWLAGVLAR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3811489-3810500 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAACGAACCGCTGTCGTCGCTGGAGCTGCTGCCGGAGGAGGAGGGCGGCGCGAACCTGACCTATTTCG
CCTTCGCCGCCCCGACCGCCTCGGCGCCGGACCTGCCGGCGGTGTTGCCCGGTCCGCTGCCGGACGTTCT
TTCCGGGCGCTACCGTCTGGAGCGGATGCTCGGCGCCGGCGGCATGGGCACGGTATACCGTGCCCGGGAC
CTGCTCCATGAGCAGTTCGGCGACCCGGCGCCGCTGGTAGCATTGAAGCTGCTCAACGAATCGGTCGCCG
AGTCACCCGACGCCAGCGCCTTGCTCTATAGCGAGTTCGCCCTGACCCGGCGCTTGCGCCATCCGAACGT
CGTGCGTCTGTTCACCTTCGACGTCGACACCGTCTGCCAGCGCGCCTACATCGTCATGGAACTCATGCCT
GGCCTGCCGCTCGATCGCCTGCTCTGCGAGCGTCCCGAAGGCCTGCCCTGGTCCGAGTTGAGCGCGATCG
CCCGGCCGTTGCTGGACGCCCTGGCCTATGTCCACGAACAAGGGGTGCTGCATGGCGACCTGAAGCCGAG
CAACGTGATGCTCGGCGAGGAGGGCGTGCGGCTCTTCGACTTCGGCCTCGGCCAGGCGCAGGCAGGCATC
CTGGACGGCCTGCCGCAGCTCAGCCGGGGCCGCATCGACGCCTGGACCCCGGGCTACGCCGCTCCCGAAC
TGCTCGAGGGTGCGCCGTTGTCGCCGGCAGCCGACCTGTATGCGCTGGCCTGCGTCCTCTACGAACTGGC
CGACGGTCGCCATCCGTTCCGCCGCCTGCCCTCGAACCAGGCCCGGGAGCAGGGGCTGGAGCGCCAGCTG
CGCGCGCCCGGACACCTGCCTCGGCGCTGCTGGCCGGCGCTGCGTACCGCCCTGAGCCTCGACCCCGAAC
GGCGCTGCATCGGCGTCCGCGAATTGCAGGAAGCGCTGGGCGCGCGGCGTTCCTGGCTGGCCGGCGTTCT
TGCCCGTTGA
 Primer design