SecReT6
Protein ID: 116050299
SecReT6 ID151
T6SS typei4a
Gene symbol-
Locus tagPA14_34150
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3037579..3038664 [+]
Producttranscriptional regulator
NoteSfa3
UniProt IDQ02MF2
KEGG IDpau:PA14_34150
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 5.80E-69, Aligned region: 22..188
Sigma54_activat [PF00158], Evalue: 5.80E-69, Aligned region: 300..308
Sigma54_activ_2 [PF14532], Evalue: 1.10E-21, Aligned region: 26..192
AAA_5 [PF07728], Evalue: 5.30E-09, Aligned region: 46..162
AAA_5 [PF07728], Evalue: 5.30E-09, Aligned region: 262..302
Mg_chelatase [PF01078], Evalue: 0.00016, Aligned region: 42..65
Mg_chelatase [PF01078], Evalue: 0.00016, Aligned region: 100..163
AAA [PF00004], Evalue: 0.00052, Aligned region: 46..162
HTH_30 [PF13556], Evalue: 0.0014, Aligned region: 315..347
HTH_8 [PF02954], Evalue: 0.0019, Aligned region: 243..259
HTH_8 [PF02954], Evalue: 0.0019, Aligned region: 308..343
AAA_16 [PF13191], Evalue: 0.004, Aligned region: 35..84
AAA_16 [PF13191], Evalue: 0.004, Aligned region: 280..300
AAA_2 [PF07724], Evalue: 0.0085, Aligned region: 42..141
Protein Sequence: 361 a.a.     [Download]
>gi|116050299|ref|YP_790884.1| sfnR gene product [Pseudomonas aeruginosa UCBPP-PA14]
MSVITHPHARELTKSVRATVLVFNDPRSRELLERIERLAPSEANALVIGETGTGKELVARHIHALSGRSG
GPFVAVNCGAFAESLVESELFGHEKGAFTGALQSKAGWFEAANGGTLFLDEIGDLPPSIQVKLLRVLQER
EVVRLGSRRPIPIDVRLVAATNVDLAEAVVAGHFREDLFYRLHVATIQLPPLRERRGDILPLAEYFIVEH
CRRLGYTSASLSPEAERKLLGHSWAGNIRELENAIHHALLVCRNRLIQPADLHLIDMRARQEPSGLRRAP
ESAAGSALEAALQALFEENREDLYEHIEETVFRAAYRFCHGNQLQTGRLLGISRNIVRARLEKIGELETS
PRHNVVSLVGK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|116048575|ref|NC_008463.1|:3037579-3038664 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGTCCGTCATCACCCATCCCCACGCCCGCGAGCTGACCAAATCGGTGCGCGCCACCGTGCTGGTGTTCA
ACGACCCCCGTTCCCGCGAGCTGCTGGAGCGCATCGAGCGCCTGGCGCCCAGCGAGGCCAACGCGCTGGT
CATCGGCGAGACCGGCACCGGCAAGGAGCTGGTGGCGCGCCATATCCATGCCCTCAGCGGACGCAGCGGC
GGCCCGTTCGTCGCGGTCAACTGCGGTGCTTTCGCCGAGAGCCTGGTGGAGAGCGAGCTGTTCGGCCACG
AGAAGGGCGCCTTTACCGGTGCGTTGCAGAGCAAGGCCGGCTGGTTCGAGGCGGCCAACGGCGGCACCCT
GTTCCTCGACGAGATCGGCGACCTGCCGCCGAGCATCCAGGTCAAGCTGCTGCGCGTGCTGCAGGAGCGC
GAGGTGGTGCGGCTCGGTTCGCGCCGGCCGATCCCCATCGACGTGCGGCTGGTGGCGGCGACCAACGTCG
ACCTGGCCGAGGCGGTGGTCGCTGGGCACTTCCGCGAGGACCTGTTCTACCGCCTGCACGTGGCGACCAT
CCAACTGCCGCCGTTGCGCGAGCGCCGCGGCGATATCCTGCCGCTGGCCGAGTACTTCATCGTCGAGCAC
TGCCGGCGCCTCGGCTACACCAGCGCGAGCCTGAGCCCGGAAGCCGAGCGCAAGCTGCTCGGGCACTCCT
GGGCGGGCAATATCCGCGAGCTGGAGAACGCCATCCACCACGCGCTGCTGGTCTGCCGCAACCGCCTGAT
CCAGCCGGCCGACCTGCACCTCATCGACATGCGTGCGCGCCAGGAGCCGAGCGGCTTGCGCCGTGCTCCC
GAGAGCGCCGCCGGCTCGGCGCTGGAAGCGGCGCTGCAGGCGCTGTTCGAGGAAAACCGCGAGGATCTCT
ACGAGCACATCGAGGAAACCGTGTTCCGCGCCGCCTATCGCTTCTGCCACGGCAACCAGTTGCAGACCGG
ACGCCTGCTGGGGATCAGCCGCAACATCGTGCGCGCCCGCCTGGAGAAGATCGGCGAGCTGGAAACCTCG
CCACGACACAACGTGGTCTCGCTGGTGGGCAAGTGA
 Primer design