SecReT6
Protein ID: 116050301
SecReT6 ID151
T6SS typei4a
Gene symbol-
Locus tagPA14_34130
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3032557..3036372 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ02MF4
KEGG IDpau:PA14_34130
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.60E-35, Aligned region: 114..354
Protein Sequence: 1271 a.a.     [Download]
>gi|116050301|ref|YP_790882.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MSGATLFMLVLLLLLLALLLGALGWWWRTRGGTEIRSFYAAVRQMEREQGWQGRYEAPWLLMLGNETEGE
QLCATWRLLPVARPAWFGRWWSDGEGAILLVPESVFLPDEGLRRQSGAWLRLLRLFLRLRGRRALDGVVW
NIPLARLQDGEQAAALGLAARRRYVELTQRLGLSLPVYVVITGLEDLPGFQELLAALPEEARERALGWSS
PFAAEAAWQSRWCEQALEEITATLTESIVELGTLRGQVNNDLYCLPPRLESLRGSLQALLEPVFQGNARG
EAPRFRGLYLSGSEAAGAASDEALPAVDAPRRRSSFASQLWARRILAEEGLAQAVPRILQLRQRWQRGIG
LVALCLCLLWGGLMTWVWRDALRDAGELSQLLHGASERYQPLDDDTRRAAQVRQNVQAWWQLVAQAPRWR
FTSLAFPSSWFSSLDARIDSAYRRVSERLLVRPLRSLLEGEASDLRAIRSDGQPGLKEGDDPSQWKDYLA
AKDLVARATTLERHNRLFAQAIDNRKTPLDDLLQLSNDALGSSYNGGSLARLAYYNRTLFAERPADLAAL
DLGRVGATAADNFHDLMARWLNAYFLTDSLERTGNALTQELAQLGQERDATAAQLLGVGELINHLQQQVN
RINLIWGNGVGQDLVPGYQNLLKSAQQSSLLGDRVEELQNLTVQLQQQFRSEWIAPPEAAGDGLLVKQGA
TLKLADDLLGLKRAIDDLKTKDFVSVALAGKTLAEHSLLSIDDIGVTQALSFFNDFSGYYESTLPSLNPR
YRYSVLHAAASATTEAMWQSLGPRSRSLTSRNASRFDVQVKQVQALQAALLELQDMQAGARLLASLNALA
VADIGQALRDIDEQAVLREPVDFSRWSGAPNFGLQAFRAQDSAELKQSLTSQFNAMAAVAERHAPALEWL
QAQQSSLATADYNAFVRFSALNAELQKFKADNPASTAAQLAKLVGNDFNQMDIGSCADILNGVLLPSSRS
DLATRLVDLRQGALGRCQSLQQQQAAQAWKDLADYFNQYLAGRFPFAYSLEAADAEPGRVRHLLKLMETR
LPQVREGLAQVRSPDLPAAEDFVRRLEQAQRWLGPLFERDKSGLLGVALDIDWRSDRSLERGADQVIAWS
LYSGDQESRFPGAQDKGLTWNVGDPLKIMLRWAKNGSQRPADDPRQASLAVADLEAGWSYQGSWALLRMM
RAHFSRQRPPNVDYTEFPLVLQLPVYAPYSPENEARMFLRLSLMSLGGKTPLSIQPLPVRAPQSPFATLL
PATVASTGGIP
 
Nucleotide Sequence: 3816 bp     [Download]
>gi|116048575|ref|NC_008463.1|:3032557-3036372 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAGCGGCGCGACGCTGTTCATGCTGGTTCTCCTCCTGCTGCTGCTGGCGCTGCTGCTGGGGGCGCTGG
GCTGGTGGTGGCGGACCCGGGGCGGTACGGAGATCCGCAGCTTCTACGCGGCGGTCCGGCAGATGGAGCG
CGAGCAGGGCTGGCAGGGCCGCTACGAAGCGCCCTGGCTGCTGATGCTCGGCAACGAGACCGAGGGCGAG
CAGTTGTGCGCTACCTGGCGCCTGCTGCCGGTGGCGCGTCCGGCCTGGTTCGGCCGCTGGTGGTCGGACG
GCGAGGGGGCGATCCTGCTGGTGCCCGAGTCGGTGTTCCTGCCCGACGAGGGCCTGCGCCGGCAAAGCGG
CGCCTGGCTGCGCCTGTTGCGTCTGTTCCTGCGCCTGCGCGGCAGGCGCGCGCTGGACGGGGTGGTCTGG
AACATTCCGCTGGCGCGGTTGCAGGATGGCGAGCAGGCGGCCGCCCTCGGCCTCGCCGCCCGTCGTCGCT
ACGTGGAGCTGACCCAGCGCCTTGGCCTGAGCCTGCCGGTGTACGTGGTGATCACTGGCCTGGAAGACCT
GCCGGGTTTCCAGGAACTTCTCGCGGCGCTGCCCGAGGAGGCGCGCGAGCGCGCCCTCGGCTGGTCCTCG
CCGTTCGCCGCCGAGGCGGCCTGGCAGTCGCGCTGGTGCGAGCAGGCGCTGGAGGAAATCACCGCCACCC
TGACCGAGTCGATCGTCGAACTCGGTACCTTGCGCGGCCAGGTGAACAACGACCTGTATTGCCTGCCGCC
ACGCCTGGAAAGCCTCCGCGGTTCGTTGCAGGCGCTGCTCGAACCGGTCTTCCAGGGCAACGCCAGGGGT
GAGGCGCCGCGCTTTCGCGGTCTCTACCTGAGCGGCAGCGAGGCGGCGGGGGCGGCAAGCGACGAAGCCC
TGCCGGCGGTCGACGCGCCGCGTCGGCGCAGCAGCTTCGCCAGCCAACTGTGGGCACGGCGGATCCTTGC
CGAGGAAGGCCTGGCCCAGGCGGTGCCGCGCATCCTCCAGCTGCGCCAGCGCTGGCAGCGCGGTATCGGC
CTCGTTGCGCTGTGCCTGTGCCTGCTCTGGGGCGGCCTGATGACCTGGGTCTGGCGTGACGCGCTGCGCG
ACGCCGGCGAACTGTCGCAACTGCTGCATGGCGCCAGCGAGCGCTACCAGCCGCTCGACGACGACACCCG
GCGCGCCGCCCAGGTCCGGCAGAACGTCCAGGCCTGGTGGCAACTGGTGGCACAGGCGCCGCGCTGGCGC
TTCACCTCGCTGGCGTTCCCCAGTTCCTGGTTTTCCTCCCTGGATGCACGTATCGACAGCGCGTATCGCC
GCGTTTCCGAGCGCCTGCTGGTGCGCCCGCTGCGCAGCCTGCTGGAAGGCGAGGCGAGCGACCTGCGGGC
GATCCGCAGCGACGGCCAGCCCGGCCTGAAGGAGGGCGACGACCCCAGCCAGTGGAAGGACTACCTGGCG
GCGAAGGACCTGGTCGCCCGCGCCACTACCCTGGAGCGCCACAATCGCCTGTTCGCCCAGGCCATCGACA
ACCGCAAGACGCCGCTCGACGATCTCCTGCAACTGAGCAACGACGCCCTGGGCAGCAGCTACAACGGCGG
CAGCCTGGCGCGCCTGGCCTACTACAACCGCACGCTGTTCGCCGAGCGTCCGGCCGATCTCGCCGCCCTC
GACCTGGGCCGGGTCGGCGCCACGGCGGCGGATAACTTCCATGACCTGATGGCACGCTGGCTGAACGCCT
ACTTTCTCACCGACAGCCTGGAACGCACCGGCAATGCCCTGACCCAGGAACTCGCGCAGCTCGGCCAGGA
ACGAGATGCCACGGCGGCCCAGTTGCTGGGGGTCGGCGAATTGATCAACCACCTGCAGCAGCAGGTCAAC
CGCATCAACCTGATCTGGGGCAATGGCGTCGGCCAGGATCTCGTCCCTGGCTACCAGAACCTGCTCAAGA
GCGCCCAGCAAAGCAGCCTGCTGGGAGATCGCGTGGAGGAACTGCAGAACCTCACGGTGCAGTTGCAGCA
GCAGTTCCGCAGCGAATGGATCGCGCCTCCGGAGGCTGCCGGCGACGGCCTGCTGGTGAAACAGGGTGCG
ACGCTCAAGCTGGCCGATGACCTGCTCGGCCTGAAACGCGCCATCGATGACCTGAAGACCAAGGACTTCG
TCTCCGTGGCCCTGGCCGGCAAGACACTGGCGGAGCACTCCTTGCTGAGCATCGACGACATCGGCGTGAC
TCAGGCGTTGAGCTTCTTCAACGACTTCAGCGGCTACTACGAGAGCACCCTGCCGTCGCTCAACCCGCGC
TATCGCTACTCGGTCCTGCACGCCGCCGCCAGCGCGACGACCGAGGCCATGTGGCAGAGCCTCGGGCCGC
GCAGTCGCAGCCTGACCAGCCGCAATGCCTCGCGCTTCGACGTGCAGGTCAAGCAGGTCCAGGCATTGCA
GGCGGCGCTGCTGGAGTTGCAGGACATGCAGGCCGGCGCGCGCCTGCTGGCCAGCCTCAACGCGCTGGCC
GTGGCCGATATCGGCCAGGCCCTGCGCGACATCGACGAGCAGGCGGTGCTGCGCGAGCCGGTCGATTTCA
GCCGTTGGTCGGGCGCGCCGAATTTCGGCCTGCAGGCGTTCCGCGCCCAGGACAGCGCCGAGCTGAAGCA
GAGCCTGACCAGCCAGTTCAATGCCATGGCCGCGGTCGCCGAGCGCCACGCCCCGGCGCTGGAGTGGCTG
CAGGCGCAGCAGTCCAGCCTGGCCACCGCCGACTACAACGCGTTCGTGCGCTTCAGCGCGCTCAACGCCG
AACTGCAGAAATTCAAGGCCGACAACCCGGCGAGCACCGCGGCGCAGCTGGCGAAGCTGGTGGGTAACGA
TTTCAACCAGATGGACATCGGCAGTTGCGCCGACATTCTCAACGGCGTGCTCCTGCCGTCCAGCCGCAGC
GACCTGGCGACGCGCCTGGTGGACCTGCGCCAGGGCGCGCTCGGGCGCTGCCAGTCGTTGCAACAGCAGC
AGGCGGCGCAGGCCTGGAAGGACCTCGCCGACTACTTCAACCAGTACCTCGCCGGACGCTTCCCGTTCGC
CTACAGCCTGGAAGCGGCCGATGCCGAGCCGGGGCGGGTGCGGCACCTGCTGAAGCTGATGGAGACGCGC
TTGCCGCAGGTGCGCGAAGGGCTGGCCCAGGTTCGCTCGCCGGACCTGCCGGCCGCCGAGGACTTCGTCC
GCCGCCTGGAGCAGGCGCAGCGCTGGCTCGGCCCGCTGTTCGAGCGCGACAAGTCGGGCCTGCTCGGCGT
CGCCCTGGACATCGACTGGCGCAGCGACCGCAGCCTGGAACGCGGCGCCGACCAGGTGATCGCCTGGAGC
CTGTACTCGGGCGACCAGGAAAGCCGGTTCCCCGGCGCGCAGGACAAGGGCCTGACCTGGAACGTCGGCG
ATCCGCTGAAGATCATGCTGCGCTGGGCGAAGAACGGCTCGCAGCGTCCGGCAGACGACCCGCGCCAGGC
CAGCCTGGCGGTGGCCGACCTCGAGGCCGGCTGGAGCTACCAGGGCTCCTGGGCGCTGCTGCGCATGATG
CGTGCGCACTTCTCCCGGCAGCGCCCGCCGAACGTCGACTACACGGAGTTTCCGCTGGTCCTGCAACTGC
CGGTGTATGCGCCCTACAGCCCGGAAAACGAGGCGCGGATGTTCCTCCGCCTGTCGTTGATGAGCCTGGG
CGGCAAGACCCCGCTGTCCATCCAGCCGCTGCCGGTGCGCGCGCCGCAATCGCCGTTCGCGACGCTGTTG
CCGGCCACCGTCGCCAGCACCGGAGGTATCCCATGA
 Primer design