SecReT6
Protein ID: 116050302
SecReT6 ID151
T6SS typei4a
Gene symbol-
Locus tagPA14_34110
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3031802..3032560 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ02MF5
KEGG IDpau:PA14_34110
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.70E-46, Aligned region: 16..229
Protein Sequence: 252 a.a.     [Download]
>gi|116050302|ref|YP_790881.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MPEGSAGPFSQAYQEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRRLWRSAFASVG
DAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQEKPLESHLYGSRQAGEYLPLAIKRLLDERAPASRDL
ANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQREADAADLGRRLEQPAAAPPRRLPVRAALPDG
FRLGLAVLGLVLLMSGIGHLFWRDIQHEMAAVTHLADAEQAP
 
Nucleotide Sequence: 759 bp     [Download]
>gi|116048575|ref|NC_008463.1|:3031802-3032560 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCCCGAAGGGAGTGCAGGGCCTTTTTCCCAGGCGTACCAGGAGCAGCCGCTCAGCACGGCATTCCGCC
AGGCCTGGCAGGAATGGCTGGAGGCCTGGGGCGCCCTCGACCGCGACGCCCAGGATGTGCCACGGATGGT
CGAGCGCGCCCTCGAACTGTCCACCCGCATCACCCGGCGTCTGTGGCGCAGCGCCTTCGCCAGCGTCGGC
GACGCGGCGGGCGTGCAGGTCAAGGCGATGGTCTATGCCTTCGTCGCCCTGGTCGACGAGACCCTGGTCT
TCAGCGCCTGGCCGGGGCAGGGCGCCTGGCAGGAAAAACCGCTGGAGTCGCATCTCTACGGCAGTCGCCA
GGCGGGCGAATACCTGCCGCTGGCGATCAAGCGCCTGCTCGACGAACGCGCCCCGGCCAGTCGCGACCTG
GCCAACGTCTACCTGCAATGCCTGATCCTCGGCTTCCGCGGTCGCCTGCGCGGGCCGCGCGGCGAGGCGC
TGCACGAGAAGTGGCGGCAGGCGCTGTTCGCCTTCGCCTGGCAGCGCGAGGCGGACGCCGCCGACCTCGG
CCGTCGCCTTGAGCAGCCTGCCGCCGCGCCGCCACGGCGCCTGCCGGTGCGCGCGGCGCTGCCGGACGGT
TTCCGCCTGGGCCTGGCGGTGCTCGGCCTGGTGCTGCTGATGAGCGGCATCGGGCACCTGTTCTGGCGCG
ACATCCAGCATGAAATGGCGGCGGTGACCCACCTGGCCGATGCGGAGCAGGCGCCATGA
 Primer design