SecReT6
Protein ID: 116050303
SecReT6 ID151
T6SS typei4a
Gene symbol-
Locus tagPA14_34100
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3030453..3031784 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ02MF6
KEGG IDpau:PA14_34100
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-68, Aligned region: 20..411
Protein Sequence: 443 a.a.     [Download]
>gi|116050303|ref|YP_790880.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MSVLPDAVCWHEGMQLLPQHFQLQGLRAEALAARTGQACNPWFWGVTALELDPSALCAGQVRILHLEAIL
PDGLPVSVQAGVDAPLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEH
PEPITVWRASLRLVGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLVLPESPLGRRVQSLCARAREKA
LFLGGRLRLAQQAGNQDDAVEVRRQLAALWTRLPEVEGLLASRAASPLALHGSLLGLAGAWAALDPLAGV
PAFEALDFLDLRRGYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGE
QAAADWLERAIVASDPHLPLLARQRMSGLARQPMNRQEQVAYSVGDDTRLFVVQGVGDWFDAGQPLRIVA
PVSGVASSPWQIVLFVADGSDNT
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|116048575|ref|NC_008463.1|:3030453-3031784 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAGTGTTCTGCCTGACGCGGTGTGCTGGCACGAAGGGATGCAACTGCTTCCCCAGCATTTCCAGTTGC
AGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCACCGGACAGGCCTGCAACCCTTGGTTCTGGGGCGTGAC
CGCCCTGGAACTGGACCCCTCGGCGTTGTGCGCCGGCCAAGTGCGGATCCTGCACCTCGAAGCGATCCTG
CCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGACGCACCGCTGGAGTTCGACCTGGAGACTGCGC
TGGCGGCCGCCGAAGGGCCGCTGCTGAACGTCCACCTGGCGGTCAGTCCGCTGTGGCGGGCGGGTCAGTT
GCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGCGCCGCTGCCGGACCTGGCCAGCGGCGAGCAC
CCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTGGTCGGCGACGACGGCAAGGCCGACTCCGTGT
GCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCTATGTCAGCCTGCCCTACGTCCCGCCGACGCC
ATTGGTGCTGCCGGAGTCGCCCCTGGGCAGGCGCGTGCAGTCGCTCTGCGCGCGGGCCCGGGAGAAGGCG
CTGTTCCTCGGCGGGCGCCTGCGCCTGGCGCAGCAGGCGGGCAACCAGGACGACGCGGTGGAAGTCCGTC
GCCAGCTCGCCGCGCTCTGGACCCGCCTGCCGGAGGTGGAAGGCCTGCTGGCAAGCCGCGCGGCCTCGCC
GCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGGGCCTGGGCGGCGCTCGATCCGCTGGCCGGCGTG
CCGGCCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGTGGCTACGAGCCGCTGCTGGACTGGCTGGAGC
GCGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGCCGTTCGAGCAGGAGGAACAGGTATTTTCCGT
GCGCCTGCCCGATCCGGCGCCGCGTCAGCGCCTGGTGGTCGGCCTGCGGATGCCCGCCGGCGCCGGCGAA
CAAGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCCTCCGACCCGCACCTGCCGTTGCTCGCCCGGC
AACGCATGAGCGGGCTGGCGCGGCAGCCGATGAATCGCCAGGAACAGGTGGCCTACAGCGTCGGCGACGA
CACCCGTTTGTTCGTCGTGCAGGGCGTCGGCGACTGGTTCGATGCCGGCCAGCCGCTGCGCATCGTCGCG
CCGGTCAGCGGGGTCGCCAGCAGTCCCTGGCAGATCGTGCTGTTCGTCGCCGACGGCAGCGACAACACCT
AG
 Primer design