SecReT6
Protein ID: 116050306
SecReT6 ID151
T6SS typei4a
Gene symbol-
Locus tagPA14_34050
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3027657..3029141 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ02MF9
KEGG IDpau:PA14_34050
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-190, Aligned region: 67..489
Protein Sequence: 494 a.a.     [Download]
>gi|116050306|ref|YP_790877.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MPKSSAAEQSGESSTQTLSLLDEIIAKGRMAHDDSQQDYARDMLAEFATQVLDEGMAVDKDTVAMINDRI
SQIDALISDQLNQIIHHPELQKLEASWRGLHQLVSNTETSARLKLRLLNVGKNELQNDLEKAVEFDQSAL
FKKIYEEEYGTFGGQPFSLLIGDFTFGRHPQDIGLLEKLSNVAAAAHAPFIAAASPRLFDMNSFTELAVP
RDLTKIFESLELIKWRAFRESEDSRYVSLVLPNFLLRLPYGPETRPVEGMNYVEDVNGTDHSKYLWGNAA
WVLAQRITEAFAKYGWCAAIRGAEGGGAVEGLPAHTFRTSSGDLSLKCPTEVAITDRREKELNDLGFISL
CHKKNSDVAVFFGGQTTNKARLYNTNEANANARLSAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQT
YLNNWIADYVLINDNAPQEIKAQYPLREARVDVSEVAGKPGAYRATVFLRPHFQLEELSASIRLVANLPP
PVAA
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3029141-3027657 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCCCAAGTCATCCGCCGCCGAACAATCCGGCGAGAGTTCGACCCAGACCCTGTCCCTGCTCGACGAGA
TCATCGCCAAGGGCCGCATGGCCCACGACGACAGCCAGCAGGACTATGCCCGCGACATGCTCGCGGAATT
CGCCACCCAGGTCCTCGACGAGGGCATGGCCGTCGACAAGGACACCGTGGCGATGATCAACGACCGCATC
AGCCAGATCGATGCGCTGATCAGCGACCAGCTCAACCAGATCATCCACCACCCCGAGTTGCAGAAGCTGG
AAGCCTCCTGGCGCGGCCTGCACCAACTGGTGAGCAACACCGAGACCAGCGCGCGGCTCAAGCTGCGCCT
GCTGAACGTCGGCAAGAACGAACTGCAGAACGACCTGGAGAAGGCGGTCGAGTTCGACCAGAGCGCACTG
TTCAAGAAGATCTACGAAGAGGAATACGGCACCTTCGGCGGACAGCCCTTCAGCCTGCTGATCGGCGACT
TCACCTTCGGTCGCCATCCGCAGGACATCGGCCTGCTGGAGAAGCTGTCGAACGTCGCCGCGGCTGCCCA
CGCGCCGTTCATCGCCGCCGCCAGCCCACGCCTGTTCGACATGAACAGCTTCACCGAACTGGCCGTGCCG
CGCGACCTGACCAAGATCTTCGAGAGCCTGGAGCTGATCAAGTGGCGCGCCTTCCGCGAGAGCGAGGACT
CGCGCTACGTGTCGCTGGTGCTGCCGAACTTCCTCCTGCGCCTGCCCTACGGCCCGGAGACGCGCCCGGT
GGAAGGCATGAACTATGTCGAGGACGTCAACGGCACCGACCACTCCAAGTACCTCTGGGGCAACGCCGCC
TGGGTCCTGGCGCAGCGCATCACCGAGGCCTTCGCCAAGTACGGCTGGTGCGCGGCGATCCGCGGCGCGG
AAGGCGGCGGCGCGGTCGAGGGCCTGCCGGCGCACACGTTCCGCACCAGCTCCGGCGACCTGTCGCTGAA
GTGCCCGACCGAGGTGGCGATCACCGACCGCCGCGAGAAGGAACTCAACGATCTCGGCTTCATTTCCCTG
TGCCACAAGAAGAACAGCGACGTGGCGGTGTTCTTCGGCGGCCAGACCACCAACAAGGCCAGGCTCTACA
ACACCAACGAGGCCAACGCCAACGCGCGCCTGTCGGCGATGCTGCCGTACGTGCTGGCGGCATCGCGCTT
CGCCCACTACCTGAAGGTGATCATGCGCGACAAGGTCGGCAGCTTCATGACCCGCGACAACGTGCAGACC
TACCTGAACAACTGGATCGCCGACTACGTGCTGATCAACGACAACGCACCGCAGGAAATCAAGGCGCAGT
ACCCGCTGCGCGAGGCGCGGGTGGATGTCAGCGAGGTGGCCGGCAAACCGGGGGCCTACCGCGCCACGGT
GTTCCTCCGGCCGCACTTCCAGCTCGAGGAACTCAGCGCGTCGATCCGCCTGGTCGCCAACCTGCCGCCG
CCGGTAGCGGCGTGA
 Primer design