SecReT6
Protein ID: 116050307
SecReT6 ID151
T6SS typei4a
Gene symbol-
Locus tagPA14_34030
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3027086..3027583 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ02MG0
KEGG IDpau:PA14_34030
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.60E-35, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|116050307|ref|YP_790876.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MDAIILDFGSDIKGDSLLVGYENKIEIMSYSHNVAMQVTNDVSNSERTSGKPHVGEFTLTKFIDTSTPTL
NEYCCAGKPIAEATITIGRNAAEGNGQIMPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELT
AQKDDGTKEGTAASTWDLAANQLVK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3027583-3027086 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGATGCGATCATTCTCGATTTCGGCAGCGACATCAAAGGCGACAGCCTGCTCGTCGGCTACGAAAACA
AGATCGAAATCATGTCCTACAGCCACAACGTGGCGATGCAGGTCACCAACGACGTCAGCAACTCGGAGCG
CACCTCCGGCAAACCCCACGTCGGCGAATTCACCCTCACCAAGTTCATCGACACCTCGACCCCGACCCTC
AACGAATACTGCTGCGCCGGCAAGCCGATCGCCGAGGCGACCATCACCATCGGCCGCAACGCCGCCGAGG
GCAACGGGCAGATCATGCCCTTCATCGTCTACACCCTGAACAACGTGGTGCTCTCCAACGTCAGCGTCAG
CGGCGGCGCCGGCGGCAAGCCGGTGGAGACCCTGTCGCTGAACTTCACCAAGATCAAGTGGGAGCTGACC
GCGCAGAAGGACGACGGCACCAAGGAAGGCACGGCCGCCTCGACCTGGGACCTGGCCGCCAACCAGTTGG
TCAAGTGA
 Primer design