SecReT6
Protein ID: 116050308
SecReT6 ID151
T6SS typei4a
Gene symbol-
Locus tagPA14_34020
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3026648..3027073 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ02MG1
KEGG IDpau:PA14_34020
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-19, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|116050308|ref|YP_790875.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MSGALPPLFERLSAEADERPAFDDRALAESVRGELLRLLNTRRPAHARSGILAYGLADWTAVQRLRAEDR
RQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGRLRSGSRLMPALFVIEQGNDGLEVRHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3027073-3026648 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCGGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAACACACGGCGCCCGGCGCATGC
GCGCAGCGGCATCCTCGCCTACGGGCTCGCCGACTGGACCGCCGTGCAACGCCTGCGCGCCGAGGACCGG
CGCCAGCTGGCACGCGAGGTGCGGGCGGCGGTCGAGCATTTCGAGCCGCGCCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGCAATCCGCAGCGCCTGCGTATCCAGCTCGGTGGCCGCCTGCGCAGCGGGTC
GCGCCTGATGCCTGCGCTATTCGTCATCGAACAGGGCAACGATGGCCTCGAGGTGCGCCATGAGCGATTC
GATTGA
 Primer design