SecReT6
Protein ID: 116050314
SecReT6 ID151
T6SS typei4a
Gene symbol-
Locus tagPA14_33960
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3017584..3019590 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ02MG7
KEGG IDpau:PA14_33960
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.60E-72, Aligned region: 31..322
Phage_base_V [PF04717], Evalue: 5.00E-23, Aligned region: 351..444
Gp5_C [PF06715], Evalue: 3.80E-15, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 3.80E-15, Aligned region: 536..557
Gp5_C [PF06715], Evalue: 3.80E-15, Aligned region: 560..583
Gp5_C [PF06715], Evalue: 3.80E-15, Aligned region: 641..654
Protein Sequence: 668 a.a.     [Download]
>gi|116050314|ref|YP_790869.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MPRPTDSNTSLSLTASALAALFPERLAGEERLNALPGWELLGYSASPLALDGAIATHLTATLHNDADQRP
LDGLVAEIRQLPGDASAERYQVLLRPWLWWLTLASNNRVFQNLATSDIVTQVFDQHGFSDYQLQLSGSYQ
PREYCVQYGESDLAFVSRLLEEDGIFWFFTHAAGKHTLVLADSNDAFPPIPNGPQVAYLGQGIGVRELQG
VRSAQYSLQAVSGTYSATDYEFTTPSTSLYSQAEAVSGAAGVYQHPGGYTAKAQGDSLTKQRIDGLRSQE
TRLIGESDCRWLVPGHWFTLSGHDDDSLNIDWVLTSVTHDASHAHYRNRFEAIPKATAYRPARVTPKPRM
HTQTALVVGKAGEEIWTDQYGRIKIQFPWDRDGKNDETSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVTF
IDGDPDRPLVTGCVYNGDNALPYALPDNQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDLNVN
VLNDSTASIGHDETLTVQNARTRTVKEGDETVTLEKGKRSVTIQTGSDSLDVKDTRTVTVGADQTHSTGG
NYSHKVSGDFELTVDGNLTIKVSGTLALQSGGSLTLKSDADLAAQAGTSLTSKAGTSLTNQAGTSLTNKA
GTSLTNDAGVSLTNKAGAEQTVDGGGMLTIKGGLVKVN
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3019590-3017584 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCCCCGTCCCACCGATAGCAATACCAGCCTCTCCCTGACCGCCTCGGCGCTGGCAGCCCTGTTCCCGG
AGCGTCTGGCCGGGGAAGAACGCCTGAACGCACTGCCCGGTTGGGAACTGCTGGGCTACAGCGCCAGCCC
CTTAGCCCTGGACGGCGCAATCGCCACCCATCTCACCGCCACCCTGCACAACGACGCCGACCAGCGTCCG
CTCGACGGCCTGGTCGCGGAGATCCGCCAACTCCCCGGCGATGCCAGCGCCGAGCGCTACCAGGTGCTGT
TGCGCCCCTGGCTCTGGTGGCTGACGCTGGCCAGCAACAACCGGGTGTTCCAGAACCTGGCCACCAGCGA
CATCGTCACCCAGGTCTTCGACCAGCACGGCTTCAGCGACTACCAGTTGCAGCTCAGCGGCAGCTACCAG
CCCCGCGAATACTGCGTGCAGTACGGCGAGAGCGACCTTGCCTTCGTCTCGCGGCTGCTGGAGGAAGACG
GCATTTTCTGGTTCTTCACCCATGCCGCCGGCAAGCACACCCTGGTGCTGGCCGACAGCAACGACGCCTT
CCCGCCGATTCCCAACGGCCCGCAAGTGGCCTACCTGGGCCAAGGAATCGGCGTGCGCGAGTTGCAGGGC
GTGCGTTCGGCGCAGTACAGCCTCCAGGCGGTATCCGGGACCTACAGCGCCACCGACTACGAGTTCACCA
CCCCGAGCACCTCGCTGTACTCCCAGGCCGAGGCGGTCTCCGGCGCCGCCGGCGTCTACCAGCACCCCGG
CGGCTACACCGCCAAGGCCCAGGGCGACAGCCTGACCAAGCAACGCATCGACGGCCTGCGCAGCCAGGAG
ACGCGCCTGATCGGCGAGAGCGACTGCCGCTGGCTGGTGCCCGGCCACTGGTTCACCCTCAGCGGGCATG
ACGACGATTCGCTGAATATCGACTGGGTGCTGACCTCGGTCACCCATGACGCCAGTCACGCGCACTACCG
CAACCGCTTCGAGGCGATCCCCAAGGCCACCGCCTACCGCCCCGCGCGGGTCACGCCCAAGCCACGCATG
CACACCCAGACCGCCCTGGTGGTGGGCAAGGCCGGCGAGGAGATCTGGACCGACCAGTACGGCCGGATCA
AGATCCAGTTCCCCTGGGACCGCGACGGCAAGAACGACGAGACCTCCTCCTGCTGGGTGCGCGTGGTGCT
GCCCTGGAGCGGCAAGGGCTTCGGCATGCAGTTCGTGCCGCGCATCGGCCAGGAAGTGATCGTCACCTTC
ATCGACGGCGACCCGGACCGCCCGCTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCCTGCCCTACG
CGCTGCCGGACAACCAGACGCAGTCCGGGATCAAGACCAACTCGTCGAAGGGCGGCGGCGGTTTCAACGA
GCTGCGCTTCGAGGACAAGAAGGACGCCGAGGAAGTCTTCCTCCAGGCGCAGAAGGACCTCAACGTCAAC
GTGCTCAACGACAGCACCGCCAGCATCGGCCACGACGAGACCCTGACGGTGCAGAACGCCCGCACCCGCA
CGGTGAAGGAAGGCGACGAGACCGTCACCCTGGAGAAAGGCAAGCGCAGCGTGACCATCCAGACCGGCAG
CGACAGTCTGGATGTGAAGGACACGCGCACGGTGACGGTGGGCGCCGACCAGACCCACAGCACCGGCGGC
AACTACAGCCACAAGGTCAGCGGCGACTTCGAGCTGACGGTGGACGGCAACCTGACCATCAAGGTCAGCG
GCACCCTCGCCCTGCAGAGCGGCGGCAGCCTGACCCTGAAGAGCGACGCCGACCTCGCCGCCCAGGCCGG
CACCTCGCTGACCAGCAAGGCCGGGACGTCGCTGACCAACCAGGCCGGCACCTCCCTCACCAACAAGGCC
GGCACCAGCCTGACCAACGATGCCGGCGTCAGCCTGACCAACAAGGCCGGCGCCGAACAGACGGTGGACG
GCGGCGGCATGCTGACCATCAAGGGCGGTCTGGTAAAGGTCAACTGA
 Primer design