SecReT6
Protein ID: 116053797
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_00910
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]89166..92474 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ02V03
KEGG IDpau:PA14_00910
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.50E-98, Aligned region: 15..52
ImcF-related_N [PF14331], Evalue: 1.50E-98, Aligned region: 117..380
IcmF-related [PF06761], Evalue: 8.20E-92, Aligned region: 159..179
IcmF-related [PF06761], Evalue: 8.20E-92, Aligned region: 429..724
DUF1215 [PF06744], Evalue: 5.60E-41, Aligned region: 619..651
DUF1215 [PF06744], Evalue: 5.60E-41, Aligned region: 840..961
AAA_10 [PF12846], Evalue: 0.0011, Aligned region: 55..212
AAA_10 [PF12846], Evalue: 0.0011, Aligned region: 523..608
AAA_16 [PF13191], Evalue: 0.0032, Aligned region: 52..180
AAA_16 [PF13191], Evalue: 0.0032, Aligned region: 519..570
AAA_16 [PF13191], Evalue: 0.0032, Aligned region: 702..769
Protein Sequence: 1102 a.a.     [Download]
>gi|116053797|ref|YP_788233.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSERRNLYELPWYVIIGPPGSGKTTALMN
SGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRR
PIDGAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDSLNREE
RAQVWGMTFALDDGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAALRECLG
EFLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIERLFREV
AFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGIESLSP
AQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTRIEEQLRSGGS
SDFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSARLDQDL
VEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTYRGYRE
VFLTASLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNVTQAADV
LRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEEGAREQPQQAD
SDPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNALYVQVSAMAGASGDSLLGDAKNQVAAAASRVALS
AERQPPVVQGLVKNVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDFGHFF
GAGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPAVRFELK
PVTMDAAISQFILDLDGQQLTYDHGPARPVAMQWPSANGLGVVRLTVTPPPSSGRSGLTLEGPWAWFRLL
DQSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL
 
Nucleotide Sequence: 3309 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c92474-89166 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCAGAGTCTCGCCGAGGTCAGCGCGCCGGACGCCGCCAGCGTCGCCACCGCCGAAGAGCTGGCGACCC
TCAAGCAACGCATGGACGAGGCCCTGGCCCTGCTCAAGCGGGCCAAGCTGGGCGGCAGCGAGCGGCGCAA
CCTGTACGAGTTGCCCTGGTACGTGATCATCGGCCCGCCCGGTTCGGGCAAGACCACCGCGCTGATGAAC
TCCGGCCTGGACTTCCCGCTCGCCGCACAGATGGGCGCCGGGGCGATCCGCGGGGTCGGCGGCACGCGCA
ACTGCGACTGGTGGTTCACCGACGAAGCGGTGCTGCTGGACACCGCCGGCCGCTATACCACCCAGGACAG
CCACGCCCAGGTGGACAAGGCCGCCTGGCTGGGCTTCCTCGACCTGCTCAAGACCCAGCGCAAGCGCCGC
CCCATCGATGGCGCGTTCATCGCCATCAGCCTTTCCGACCTGCTGCTGGGCAGCGACGCCGAGCGCGCCG
CCCATGCCCAGGCGATCCGCGCGCGCATCCAGGAGCTGTACCAGCAGCTCGGGGTGCGCTTCCCGATCTA
CGTGATGCTGACCAAGTTCGACCTGGTGCCGGGCTTCATGGAGTTCTTCGACAGCCTGAACCGCGAGGAA
CGCGCGCAGGTCTGGGGGATGACCTTCGCCCTCGACGACGGCAAGAGCGCGGAAGGCCCGCTGGCGGTGT
TCGACAGCGAATTCGCCCTGCTCGAACAGCGTCTCACCGCGCGCCTGGTGGAACGCCTGCAGCAGGAGCG
CGACCCGGCGCGGCGCGACCTGGTCTACGGCTTCCCGCAGCAATTCGCCGCCCTGCGCGAATGCCTCGGC
GAGTTCCTCAACGGCGTGTTCAAGCCCAACCCCTACGAGGAACGCCCGCTGTTGCGCGGCCTGTACTTCA
CCAGCGGAACCCAGGAAGGCAGTCCGATCGACCGCCTGATCGGCAGCATGGCGCAGTCGATGAACCTCGA
CCGCCAGCACCTGGCGCGGCAGACCGGAACCGGGCGCAGCTACTTCATCGAGCGGCTGTTCCGCGAAGTG
GCGTTCGGCGAACGCGGCCTGGTCGGCACCAACCCGAAGGTCGAGCGCCGCCGCAAATGGCTGACCATCG
GCGCGCTGAGCGCCACCGCGCTGGTGGTGCTGGCGGTGACGGCGGTATGGATCGCCAGCTACCGCGCCAA
CCAGAGCTACATCGCCGCGGTCGACCAGCGCGTCGACCCGCTGGCGCGCGGCATCGAGTCGCTGAGCCCG
GCCCAGCGCGACGTCCTGGCCGTACTGCCACAGCTCAACGCGGTGCAGAATCTCGCCGGCGACGCGCCAA
GCTGGGCCGAAGGCTACGGGCTGTACCAGGGCGACATGCTCGGCGAGGAGTCCGCCAGCGTCTACCGCAA
GCTGCTGATCGCGGTGTTCGCCCCGCGCCTGGTGACCCGCATCGAGGAACAGTTGCGCTCCGGCGGCAGC
AGCGATTTCCTCTACGAGGGCCTGAAGGCCTACCTGATGCTCGGCAGCCCGGACCATTACGACGCCGACT
TCATCAAGGCCTGGATCAGCCTCGACTGGGAACGCAACCTGCCGCGCGACCTCTCGCCGGAACAGCGCCA
GGCGCTGCACGCGCACCTCGACGCGTTGCTCGAACGACGGCCGCCGTCGGCGCGCCTGGACCAGGACCTG
GTCGAGGACCTGCGCCGCCAGTTGCAGCAACTACCGGTGGCGCAGCGGGTCTACGACCGGGTCAAGCGGC
AGAGGCTGCCCAAGGACGTGCCCGACTTCCGCATCAGCGACGCCGCCGGCCGCGACGCACCGCTGGTGTT
CGCGCGCAAGAGCGGCAAGCCGCTCACCGACCCGCTCAGCGGCTTCTTCACCTACCGCGGCTATCGCGAG
GTGTTCCTCACCGCCAGCCTCAGCCAGGCCGGCACCATCGCCGAGGAACAGTGGGTGCTCGGGCGCGACC
TGAACGATGCCGGCGATGCCGCCAACCTGGCCCTCGACGTGCGTCGCCTGTACTTCCAGGACTACCTGCG
GCAATGGGACGACCTGCTCGCCGACCTCACCGTGGTGCCGATCACCAACGTCACCCAGGCCGCCGACGTG
CTGCGCATTCTCTCCGGGCCGACCTCGCCGTTCCGCAAGCTGCTCGAGGCGGTGGCCCGCGAGACCGACC
TGCAGAAGGGCGACCGGCTGGTCGCCGCGCAAGTGAAGAAGGCCGCCGACGGCACCGTGGACAAGCTCAA
GCAGCGCCTCGGCTCGCTGGTCGGCCAGGAGGAGGAGGAAGGCGCCCGCGAACAGCCGCAGCAGGCCGAC
AGCGACCCGATCAGCGCCCACTTCGCCGAACTCAACAGCCTGGTCAGCAAGGGCGAGGGCGGCAACGAGC
CGGCGCCGATCGACAGCCTGCTGGAGGACATGAACGCGCTCTACGTACAGGTCAGCGCCATGGCCGGAGC
CAGCGGCGACTCGCTGCTCGGCGACGCCAAGAACCAGGTGGCCGCCGCCGCCTCGCGCGTGGCCCTCAGC
GCCGAGCGCCAGCCGCCGGTGGTCCAGGGCCTGGTGAAGAACGTGGTCAACTCCACCACCAGCAGCATGA
TGGGCAGCGTGCGCAACCAGCTCAACGCGGCCTGGATCAGCGACGTGGTCAGCGTCTACCGGCAGTCCCT
GGCCGGGCGCTACCCGATCGCCGCCGGCAGCTCGCGCGACGCCACCCTGGAAGACTTCGGCCACTTCTTC
GGTGCCGGTGGGGTGATGGACAGCTACTTCCGCCAGTACCTGCAACCCTACGTCGACACCTCCGCCAGCA
CCTGGCGCTGGCAGCCCGGCGCGGCGCAGAAGCTCGGCATCAACCCCGGCGTGCTGCACACCTTCCAGCG
CGCGGCGGCGATCCGCGACGCCTTCTTCCGCTCCGGCGGCATGCAGCCGGCGGTGCGCTTCGAACTCAAG
CCGGTGACCATGGACGCGGCGATCAGCCAGTTCATCCTCGACCTCGACGGCCAGCAGCTGACCTACGACC
ACGGCCCCGCCCGCCCGGTGGCGATGCAGTGGCCGAGCGCCAACGGCCTCGGCGTGGTCCGCCTGACGGT
GACGCCGCCGCCCAGCAGCGGCCGTTCCGGCCTGACCCTGGAGGGCCCCTGGGCCTGGTTCCGCCTGCTC
GACCAGTCGGACCTGGAACGCGGCAACTCGCCGGACCGCTTCACCCTGCGGCTGCGCATCGACGGCTCCA
GCATCGCCTGCGAGCTGCGCGCCAGCAGCGCCTTCAACCCCTTCAAGAGCCGGGTCGTGTCCGGCTTCAG
CCTCCCGGAGCGCCTTTGA
 Primer design