SecReT6
Protein ID: 116249129
SecReT6 ID147
T6SS typei5
Gene symbolimpL
Locus tagpRL120464
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]498599..502075 [-]
ProductImcF family transmembrane protein involved in nitrogen fixation
NoteTssM
UniProt IDQ1M400
KEGG IDrle:pRL120464
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.80E-70, Aligned region: 207..447
ImcF-related_N [PF14331], Evalue: 1.80E-70, Aligned region: 513..581
IcmF-related [PF06761], Evalue: 9.00E-70, Aligned region: 497..796
IcmF-related [PF06761], Evalue: 9.00E-70, Aligned region: 843..875
DUF1215 [PF06744], Evalue: 3.60E-35, Aligned region: 899..1020
Protein Sequence: 1158 a.a.     [Download]
>gi|116249129|ref|YP_764970.1| ImcF family transmembrane protein involved in nitrogen fixation [Rhizobium leguminosarum bv. viciae 3841]
MNPLSYFYTLRSYVEAYAGLIGRRFISIIWVAAICVVIWFYGYLAVYGDFKPLASASARLTLIGIILAAW
LAYLVFTTIRDRRRDKQLVDGIERDAQAEAAASQQAEVGEIHGRLKEALQLLRRITKKRFGYIYELPWYV
IFGAPGSGKTTALTNSGLKFPLGDALGSNSVQGIGGTRNCNWWFTDEAILIDTAGRYTTQDDLNGTAKAG
WEGFLGLLRKYRRSQPINGALVTLSIGDLLTRDPEAQREEIRAIRQRLSELDELLHARVPVYLLLTKADL
LTGFVEFFDGFNKSDREQVWGTTFGLDESYKAANLPERFTEEFTLLQQRVDSMLIERLQQEPNPELRGRI
FRFLAELTSLKERLHEVVTELCSGSKLVEAPLLRGIYFASSTQREETVTVPRMRRSYFLSRLFKEVIFGE
ASLVARDKRLSGRQLLFRRAAYASAVLLLAVVLTSWTATYIQNATALAGAERRIDAYEQLVRGVPVRDVS
DTDFLRILPALDNLAAVTTDFSKTRVWPISLGLDQEGKVASRQREAYQRALNTLLLPRMLVQLQKDMTET
TDVTRTFDALKLYGMLGGLGPVNADFAALEAEDMFTRLYPDEGRAAARQALIAHADVMARGALPPIELDK
ALIAKAREVIRSQNIANRAYDILAEYRESRALPAWSPAGALGPLGEQAFERTSKAPLNEGIPGLFSATGY
RTVVLPGITDAAREALDEQWVRRDPNPAGVTVDTIAQATLQLYFDAFEQRWSMILTDIRVKPSQTIGDAA
ETTRILAGKPGPVETITKSIVAATDLRAPGAEIASAAGDSLPASTTALASAANAPDPFGRLRDALKAPAG
QSSPDDQPKDAPRSEIGQLEPILQRVQEQLSRATTSTAEVAKVFDVDSQLTDANQDLLQQARKLPAPVDT
WMAGLAADVGSLAVKSARSRISDAWAAEGAGFCSNVVAGRYPFDRKSPRDVAMSDFIRLFGPEGLFKTFF
KEKLEAFVDTSASPWGWKGTFGAVSIPSAAIAQFENADKINRAFFPAGSENPSISINVKPVSLTEAASAV
MLEIEGERVVYFHGPIQSKSITWPSTDASNVSRLAFQPGGWQQALTENGDWSPFRLFDDADLAIQGDDLF
RAKFQQSGQAAEFDVQFGSVLNPFRLEALGAFSCPAQF
 
Nucleotide Sequence: 3477 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c502075-498599 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGAACCCGCTCAGTTATTTCTATACGCTCCGCTCCTATGTGGAGGCCTATGCCGGCCTCATCGGCCGTC
GCTTCATCTCGATCATCTGGGTGGCGGCAATCTGTGTCGTCATCTGGTTCTACGGCTATCTCGCCGTCTA
TGGCGACTTCAAGCCGCTGGCGAGCGCTAGCGCGCGGCTGACGCTGATCGGCATCATCCTCGCTGCCTGG
CTCGCTTATCTCGTCTTCACGACCATCCGCGACCGACGCCGCGACAAGCAGCTCGTCGACGGTATCGAGC
GAGACGCGCAAGCGGAAGCCGCGGCTAGCCAACAGGCTGAGGTCGGCGAGATCCACGGTCGGCTCAAGGA
AGCGCTGCAGCTGCTCCGCCGCATCACCAAGAAGCGCTTCGGCTATATCTATGAGCTGCCATGGTACGTC
ATCTTCGGCGCGCCGGGGTCCGGCAAGACGACTGCGCTCACCAATTCCGGCCTCAAATTCCCGCTCGGCG
ATGCGCTCGGCAGCAATTCGGTGCAGGGGATCGGCGGTACGCGCAACTGCAATTGGTGGTTCACCGACGA
GGCCATCCTCATCGATACGGCCGGCCGCTATACGACACAGGACGATCTGAACGGCACCGCCAAGGCCGGC
TGGGAAGGATTTCTCGGCCTGCTGCGCAAGTACCGGCGTTCGCAGCCGATCAACGGCGCCCTGGTGACGC
TGTCGATCGGCGATCTCCTGACGCGCGATCCGGAAGCGCAGCGCGAGGAGATCAGGGCGATCCGCCAGCG
GCTTTCCGAACTCGATGAACTCCTGCATGCGCGCGTGCCGGTCTATCTGCTGCTGACCAAAGCCGATCTC
TTGACCGGCTTCGTGGAGTTCTTCGACGGTTTCAACAAAAGCGACCGCGAACAGGTCTGGGGCACGACTT
TCGGGCTAGACGAGAGCTATAAGGCGGCGAACCTGCCGGAACGCTTCACGGAGGAATTCACCCTGCTGCA
GCAGCGCGTCGATAGCATGCTGATCGAACGCCTGCAGCAGGAGCCTAATCCGGAATTGCGCGGCCGCATC
TTCCGTTTCCTGGCCGAACTCACCTCTTTGAAGGAGCGTCTGCACGAGGTCGTCACCGAGCTTTGCTCGG
GTTCCAAGCTGGTGGAGGCGCCGCTGCTGCGCGGCATCTATTTCGCTTCCAGCACCCAGAGGGAGGAGAC
AGTCACCGTGCCCCGCATGCGGCGCAGCTATTTCCTCTCGCGGCTCTTCAAGGAGGTGATCTTCGGCGAG
GCCTCGCTAGTCGCCCGCGACAAGCGGCTTTCGGGGCGGCAGCTGCTCTTCCGCCGCGCGGCCTATGCGA
GCGCGGTCCTGCTGCTTGCCGTGGTGCTGACCAGCTGGACGGCCACCTACATCCAGAACGCCACGGCGCT
GGCCGGCGCGGAAAGACGCATCGACGCCTACGAACAACTGGTGCGTGGCGTGCCGGTTCGCGACGTTTCG
GATACGGATTTCCTGCGCATCCTGCCGGCGCTCGACAATCTCGCAGCAGTCACCACCGACTTCTCGAAGA
CCCGCGTCTGGCCGATAAGCCTCGGCCTCGACCAGGAAGGCAAGGTCGCCAGCCGGCAGCGCGAGGCCTA
TCAGCGGGCGCTGAACACGCTGCTCCTGCCGCGCATGCTGGTGCAGCTCCAGAAGGACATGACCGAGACC
ACCGACGTCACCCGAACCTTCGACGCGCTGAAGCTCTACGGCATGCTCGGCGGGCTCGGCCCGGTGAATG
CAGACTTTGCCGCGCTGGAAGCAGAAGACATGTTCACGAGGCTCTATCCCGACGAAGGCAGGGCCGCGGC
CCGGCAGGCGCTGATTGCCCATGCCGATGTCATGGCGCGCGGCGCGCTGCCGCCGATCGAGCTCGACAAG
GCGCTGATCGCCAAGGCGCGCGAGGTCATCCGCTCGCAGAACATCGCCAACCGCGCCTATGACATCCTGG
CGGAATATCGCGAGTCCCGCGCGCTTCCCGCCTGGAGCCCGGCAGGCGCGCTGGGGCCGCTTGGCGAACA
GGCTTTCGAGCGCACCTCGAAGGCGCCGCTCAACGAAGGCATTCCCGGCCTCTTCTCCGCGACCGGCTAT
CGCACCGTCGTTCTGCCTGGGATCACCGACGCCGCGCGCGAGGCGCTCGACGAGCAATGGGTCCGCCGCG
ACCCCAATCCCGCCGGCGTCACGGTCGACACGATCGCCCAGGCGACGCTTCAGCTTTACTTCGACGCATT
CGAGCAGCGCTGGTCGATGATCCTCACCGATATCAGGGTGAAGCCTTCCCAGACGATTGGCGATGCGGCG
GAAACCACCCGCATCCTGGCGGGCAAGCCCGGCCCGGTCGAGACGATCACCAAATCAATCGTCGCTGCCA
CCGATCTACGCGCGCCCGGGGCGGAAATCGCCTCGGCCGCCGGCGACAGCCTGCCAGCCTCGACTACGGC
GCTTGCCAGCGCAGCGAATGCGCCCGATCCCTTCGGCCGTCTTCGAGATGCGCTGAAGGCGCCGGCCGGC
CAATCGTCGCCGGACGACCAGCCGAAGGATGCGCCGCGATCGGAGATCGGGCAGCTCGAGCCGATCCTGC
AGAGGGTCCAGGAGCAGCTTTCGCGCGCCACGACGTCGACGGCCGAAGTCGCGAAAGTCTTCGACGTCGA
CAGCCAGCTCACCGACGCCAATCAGGACCTGCTGCAGCAGGCGCGCAAGCTCCCGGCGCCGGTCGATACC
TGGATGGCGGGGCTGGCTGCGGATGTCGGATCGCTGGCGGTCAAATCCGCCCGATCACGCATCAGCGACG
CCTGGGCTGCCGAAGGCGCGGGCTTCTGCTCGAATGTCGTCGCCGGTCGTTATCCCTTCGACCGGAAATC
TCCGCGCGACGTGGCGATGAGCGATTTCATCAGGCTTTTCGGACCCGAGGGGCTGTTCAAGACCTTCTTC
AAGGAAAAGCTCGAAGCCTTCGTCGACACCAGCGCCTCGCCATGGGGCTGGAAGGGCACGTTCGGCGCGG
TAAGCATTCCGAGTGCGGCGATTGCCCAGTTCGAGAATGCCGACAAGATCAACCGCGCCTTCTTCCCGGC
CGGCAGCGAGAACCCGTCGATATCAATCAACGTCAAGCCGGTATCGCTGACCGAGGCGGCCAGCGCCGTG
ATGCTGGAGATCGAGGGCGAACGCGTGGTCTATTTCCACGGGCCCATCCAATCGAAATCGATCACCTGGC
CGTCGACGGACGCCAGCAACGTTTCGCGCCTCGCCTTCCAGCCGGGCGGCTGGCAGCAGGCGCTGACAGA
GAACGGCGACTGGTCGCCCTTCCGGCTTTTCGACGATGCCGATCTCGCCATACAGGGCGACGACCTCTTC
CGGGCAAAGTTCCAGCAGAGCGGCCAGGCAGCAGAGTTCGACGTGCAGTTCGGTTCGGTGCTCAATCCAT
TCCGGCTGGAGGCGCTCGGCGCCTTCTCATGCCCGGCGCAATTCTGA
 Primer design