SecReT6
Protein ID: 116619365
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0223
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]299183..302560 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDQ02CI0
KEGG IDsus:Acid_0223
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.60E-57, Aligned region: 467..768
ImcF-related_N [PF14331], Evalue: 6.30E-39, Aligned region: 159..421
DUF1215 [PF06744], Evalue: 1.60E-20, Aligned region: 585..614
DUF1215 [PF06744], Evalue: 1.60E-20, Aligned region: 846..969
Protein Sequence: 1125 a.a.     [Download]
>gi|116619365|ref|YP_821521.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MIALYLLGLVAIILVVLVGVWFYLKKKKAAHDGAAGGDSSAPGAEDIDALVREAEQRLAAAKLGDRLAGL
PVLFLAGDTGSTKTSVMVNAGLEPELLAGLVYQDKNLVPTRTANLWFSRRTIFAEAGGKLLTEPAKWNRL
IRKLQPRASVASQGAQAPRAVLVCYDAETFTRPGAQEAATAAARNLRTRLGEMSQAFGINLPVYVLFTKM
DRLPYFTEYVRNLTREESGQVLGVTIPMRDVRAGGVYGEEQTARLNADFESLFRSLADARPEFLARETDA
AIQPGAYEFPREFRKIRPAVVQFLVDICQPSQLTVGPFLRGFYFTGVRPIVINEVAPVAPAPQAKAGYGS
AAGTTGLFQAGPAAQAPQAQPVGATRKVPQWLFLSHLFNDVLLADRAAMGASGSSVKAGFARRALFLAAA
VLCLLLSIAFTVSFFNNRALETQARDAALGISSAESSGQNLASLDALRKLEALRQSLETLTTYRREGEPW
SYRWGLYTGDSLYPEVRRIYFDRFHQLLFLQTQSAMLENLRGLPVGTQGPEYGPTYDALKAYLITTSNHD
KSTKLFLTPVLTKWWSGNRGPDAERIALAQKQFDFYATELKEENPFAKENDAVAIERARAYLKQFAGAER
VYSFMLAEAGKTNPPIDFNRQFPGSAQVVTQPHVVPGAFSKGGWTFMKDAIAHADRYFNGEQWVLGDQVA
GNIDRAALAQGLHDRYYSDFVKEWRTYIKSANVVRYAGLKDATTKLAQLAGNQSPLLELFALASTNTAVD
DPAVAKVFQAVQAVVPPGSTDRFIAPSNQNYMNALVAIQTSLEAIANQPGAPNDAAAAQTVTNATQAKVN
TRQMAQAFTIDAEGHIEASVQKLLEDPITYLDAMLRSIDTPEINAGGKALCGSFRPVLSKYPFSASASSE
ATLADINTLFRKPDGLIWTFFDQKLQKVLIRQGAQFVQNPSSKVTVNPAFLNFFNTAAAFGEALYADGGQ
DPHFSYSLKPETTEGVQMLTVRLDGQTLTYNAGTAAAFKKFNWQGSGTHEALLSVRFGTQDLGLASGEGL
WAAFHLFQLADTQSAGAGGTQVLDWVAKSGKAGQPMLLGSGKPLTVRLDLDLGAAPPLFQRGYLSRMTCV
QEIAR
 
Nucleotide Sequence: 3378 bp     [Download]
>gi|116619145|ref|NC_008536.1|:c302560-299183 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGATTGCACTCTATCTCCTCGGCTTGGTGGCGATCATCCTGGTCGTGCTGGTTGGCGTTTGGTTCTACC
TGAAGAAAAAGAAGGCTGCGCACGATGGCGCCGCGGGAGGCGATTCCAGCGCACCGGGCGCGGAGGACAT
CGACGCTCTGGTGCGTGAGGCGGAGCAGCGCCTGGCCGCCGCCAAACTGGGCGATCGTCTCGCCGGCCTC
CCTGTGCTTTTCCTGGCGGGCGACACCGGCAGCACGAAGACCAGCGTCATGGTCAATGCCGGGCTCGAAC
CCGAATTGCTGGCCGGCCTCGTCTATCAGGACAAGAACCTGGTGCCCACGCGTACCGCCAACCTCTGGTT
CTCGCGGCGCACCATTTTTGCGGAAGCCGGCGGTAAACTGCTTACCGAACCCGCCAAGTGGAACCGCCTG
ATCCGAAAGCTTCAGCCCCGAGCCTCGGTGGCGAGCCAAGGCGCCCAGGCGCCGCGCGCGGTGCTGGTCT
GCTACGACGCCGAAACCTTCACGCGCCCAGGCGCCCAGGAGGCCGCGACCGCGGCCGCGCGCAATCTGCG
TACCCGCCTGGGCGAGATGTCCCAGGCCTTCGGCATCAACCTGCCGGTCTATGTACTCTTCACCAAAATG
GACCGTCTGCCGTATTTCACCGAGTACGTCCGCAATCTCACCCGCGAGGAATCGGGACAGGTCCTCGGCG
TCACCATCCCAATGCGCGATGTGCGGGCGGGGGGCGTGTACGGAGAAGAGCAGACGGCGCGCCTGAACGC
GGATTTCGAGAGTCTTTTCCGTTCCCTGGCCGACGCCCGTCCTGAATTCCTCGCGCGCGAGACGGATGCC
GCCATACAACCCGGCGCCTACGAATTTCCGCGTGAGTTCCGCAAGATCCGTCCCGCCGTGGTGCAATTCC
TGGTGGACATCTGCCAGCCCAGCCAGTTGACCGTCGGACCATTTCTTCGTGGATTCTACTTTACCGGCGT
ACGGCCCATCGTGATCAACGAGGTGGCGCCGGTCGCCCCGGCGCCGCAGGCGAAAGCCGGTTACGGCTCC
GCCGCCGGCACCACGGGTTTGTTTCAAGCGGGCCCGGCGGCGCAGGCTCCTCAGGCACAGCCCGTGGGAG
CTACCCGCAAAGTTCCGCAGTGGCTGTTCCTGAGCCATCTCTTCAACGATGTGCTGCTAGCCGATCGCGC
CGCTATGGGAGCCAGTGGTTCCAGCGTCAAGGCCGGCTTCGCGCGGCGGGCGCTCTTCCTGGCCGCCGCA
GTCTTGTGCCTGCTCCTGTCGATTGCTTTCACGGTTTCGTTCTTCAACAACCGGGCGCTGGAGACACAAG
CCCGCGATGCGGCGCTCGGCATTTCGTCGGCGGAATCCTCGGGCCAGAACCTCGCGTCGCTGGACGCACT
GCGCAAACTCGAGGCGCTGCGCCAGTCGCTCGAAACCCTCACCACCTACCGCCGCGAAGGCGAGCCCTGG
AGCTATCGCTGGGGCCTATATACCGGCGACTCCCTCTACCCCGAAGTCCGGCGCATTTACTTCGACCGTT
TCCACCAGTTGCTGTTCCTACAGACCCAGAGCGCGATGCTGGAGAATTTACGCGGTCTTCCAGTGGGAAC
CCAGGGCCCCGAATACGGGCCTACTTACGACGCCTTAAAGGCATACCTCATCACCACCTCGAACCACGAC
AAAAGCACCAAGCTCTTCCTCACGCCGGTCCTCACAAAATGGTGGTCCGGCAACCGCGGTCCGGATGCCG
AACGCATCGCTTTGGCGCAAAAACAGTTCGACTTTTATGCCACCGAACTCAAGGAAGAGAACCCCTTCGC
CAAGGAGAACGACGCCGTGGCAATTGAACGCGCCCGCGCTTATCTGAAGCAGTTCGCCGGCGCCGAGCGC
GTCTATTCGTTCATGCTTGCGGAGGCTGGCAAAACCAATCCCCCCATCGATTTCAATCGCCAGTTCCCAG
GCTCCGCTCAAGTTGTGACTCAGCCGCACGTGGTTCCCGGCGCCTTCTCCAAGGGCGGTTGGACTTTCAT
GAAGGATGCGATCGCCCATGCCGACCGTTACTTCAACGGAGAACAGTGGGTCCTTGGCGACCAGGTGGCG
GGGAACATCGACCGCGCCGCGCTTGCCCAGGGGCTGCATGACCGCTACTACTCGGACTTCGTGAAGGAGT
GGCGCACTTACATCAAGTCGGCCAACGTGGTCCGCTATGCCGGGCTGAAAGACGCCACCACGAAACTGGC
GCAGCTTGCCGGCAACCAATCCCCGCTGCTCGAGCTGTTCGCCCTGGCCTCCACCAATACCGCGGTGGAT
GATCCCGCTGTGGCCAAGGTCTTCCAAGCGGTCCAGGCCGTAGTCCCGCCGGGCAGCACGGACCGGTTCA
TCGCGCCGTCCAACCAGAACTACATGAACGCCCTGGTCGCGATTCAGACCTCGCTCGAAGCCATCGCCAA
CCAGCCGGGCGCGCCCAACGATGCGGCGGCGGCGCAGACCGTTACCAACGCCACCCAGGCCAAGGTCAAC
ACCCGTCAAATGGCGCAGGCGTTCACGATCGACGCCGAAGGCCACATCGAGGCCAGCGTGCAGAAACTGC
TCGAAGACCCCATCACTTACCTGGACGCCATGCTACGCTCCATCGATACGCCGGAGATCAACGCCGGCGG
CAAGGCCCTGTGCGGCAGCTTCCGTCCTGTGCTCAGCAAGTATCCCTTCAGTGCTTCCGCCTCGAGCGAA
GCCACCCTGGCCGATATCAATACATTGTTCCGCAAGCCGGATGGCCTGATCTGGACCTTCTTCGATCAGA
AACTGCAAAAGGTGCTCATTCGTCAGGGCGCTCAGTTTGTGCAAAACCCCAGTTCCAAAGTGACCGTGAA
CCCCGCGTTCCTTAACTTCTTCAATACCGCTGCCGCTTTTGGCGAGGCGCTTTATGCGGATGGCGGACAG
GACCCTCACTTTTCCTACTCCTTGAAGCCCGAGACCACCGAAGGAGTTCAGATGCTCACCGTACGATTGG
ATGGGCAGACGCTGACCTATAACGCTGGGACCGCCGCAGCCTTCAAGAAATTCAACTGGCAGGGCAGCGG
AACGCATGAGGCCCTGTTAAGCGTGCGCTTCGGGACGCAGGACCTCGGGCTGGCGAGCGGTGAAGGCCTT
TGGGCCGCCTTCCATCTCTTCCAACTCGCCGATACGCAATCCGCCGGCGCGGGCGGGACGCAGGTGCTCG
ACTGGGTCGCGAAATCCGGCAAAGCCGGACAGCCCATGCTGCTCGGCAGCGGCAAACCGCTGACGGTCCG
GCTCGACCTCGATCTGGGTGCCGCCCCCCCGCTCTTTCAGCGCGGCTATCTTTCGCGCATGACCTGCGTC
CAGGAGATCGCCAGGTAG
 Primer design