SecReT6
Protein ID: 116619366
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0224
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]302569..303273 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ02CH9
KEGG IDsus:Acid_0224
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-51, Aligned region: 12..217
Protein Sequence: 234 a.a.     [Download]
>gi|116619366|ref|YP_821522.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MPPSADTRRPENLALLFQDVLTAIVRLRSNRQGVIDPAAFRHQIREALKSAASRALSAGYTADDARHATF
ATVAFLDESVLNSGNPIFSEWLRKPLQAELFGTHTAGEEFFVSLQQLLGRADSADLADLIEIHYLCLLLG
FGGRYSAGNRGELAQIMNLTGEKIRRIRGRFGALSPSWQPSNETVASQSDPWVKRWGIVAAVCALVTVLL
FAGYMFGLSSVVSQLRTLSTQGKG
 
Nucleotide Sequence: 705 bp     [Download]
>gi|116619145|ref|NC_008536.1|:c303273-302569 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGCCTCCTTCGGCCGATACCCGCAGACCAGAGAATCTGGCGCTGCTCTTTCAGGATGTTCTGACCGCTA
TTGTCCGGCTGCGCAGCAATCGCCAGGGCGTGATCGACCCCGCGGCCTTCCGCCACCAGATCCGCGAGGC
TCTGAAGAGTGCCGCCAGCCGGGCTCTCAGCGCCGGCTACACGGCGGATGACGCACGCCACGCTACCTTC
GCCACGGTCGCGTTCCTGGATGAGTCCGTCTTGAATTCCGGCAATCCGATTTTTTCGGAATGGCTGCGCA
AACCGCTCCAGGCCGAGTTGTTCGGCACTCACACTGCCGGCGAGGAGTTCTTCGTCAGCCTGCAGCAACT
GCTGGGCCGCGCCGATTCGGCGGACCTAGCCGACCTGATCGAGATCCACTATCTTTGCCTCCTGCTCGGC
TTTGGCGGCCGCTATAGCGCCGGCAACCGTGGTGAACTGGCACAAATCATGAACCTGACCGGCGAGAAGA
TCCGTCGCATCCGCGGACGATTCGGCGCGCTGTCACCCTCCTGGCAGCCATCGAACGAGACTGTGGCCAG
CCAGAGCGATCCCTGGGTCAAACGCTGGGGCATCGTGGCGGCCGTCTGCGCCCTGGTAACGGTGCTGTTG
TTTGCGGGCTACATGTTCGGTCTGAGTTCGGTGGTGTCGCAGTTGCGGACTCTTTCCACGCAAGGGAAAG
GCTAG
 Primer design