SecReT6
Protein ID: 116619367
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0225
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]303278..304654 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ02CH8
KEGG IDsus:Acid_0225
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.60E-127, Aligned region: 27..455
Protein Sequence: 458 a.a.     [Download]
>gi|116619367|ref|YP_821523.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MLKYADSHMKLLSRVVWSEGMHLGPHHFQVQSRYFEDSIQFATSALWFASYGLAGLELDADALYNGSVSL
LHARGILPDGLPFNMPECDDLPQPRAIADLIPPTREGVLVLLGIPPLRPNGLNCTLDVRSAAPVQGDARY
ASEPKILHDEISGVDERTVQLGRKNLRLLLDTEPAHDLVTIPIARVVRDGAGHFAYDPAFVPPVVQIGAS
PRLLQLLQQMVEILDDKGSALSRDAGASRDFSTREIAAFWLLHAINSALAPLRHLLIAKRGHPEELFVEL
SRLSGALCTFSLDSHPRDLPLYDHQNLTDCFTRLESHIRIHLETVLPTNCIAIPLEAAGDCFYEGKITDP
RCLGNSRWVLGIRAGVPDAELMTQVPQLVKVCTPVFVRELVNRALPGMPLTHLPVPPAAISTQVETQYFG
ISRTGPCWNHMLQTRQVGVYVPSAFPNPELQVLVVLDS
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|116619145|ref|NC_008536.1|:c304654-303278 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGCTAAAGTATGCGGACAGCCATATGAAGCTGCTTTCGAGAGTAGTCTGGTCAGAAGGCATGCACCTCG
GCCCCCACCATTTCCAGGTGCAGAGCCGCTACTTCGAAGACTCGATCCAATTTGCCACCTCGGCGCTCTG
GTTTGCATCCTACGGCCTCGCGGGCCTGGAGTTGGACGCGGACGCGCTTTACAACGGCTCGGTCTCGCTG
CTCCACGCGCGCGGCATCCTGCCCGACGGCCTGCCATTCAACATGCCGGAATGCGACGACCTCCCGCAGC
CGCGCGCGATTGCGGATCTGATCCCTCCTACCCGGGAGGGTGTCCTTGTGCTGCTAGGCATTCCCCCGCT
CCGGCCGAACGGGTTGAACTGCACGCTGGATGTGCGCAGCGCCGCGCCGGTCCAAGGCGATGCCCGCTAT
GCCTCCGAACCCAAAATCCTCCACGATGAGATTTCCGGAGTCGATGAACGAACCGTACAGTTAGGCCGCA
AGAACCTGCGCCTGCTGCTCGATACGGAGCCGGCCCACGACCTGGTGACCATTCCTATCGCCCGCGTGGT
GCGTGACGGCGCGGGCCATTTCGCCTACGATCCAGCCTTCGTGCCGCCCGTGGTCCAGATCGGCGCCAGT
CCCCGGCTGCTCCAGTTGTTGCAGCAGATGGTTGAAATCCTGGACGACAAGGGTTCCGCCCTGAGTCGCG
ACGCGGGCGCTTCGCGCGACTTCTCGACCCGCGAGATTGCGGCCTTCTGGCTGCTACACGCCATCAATTC
CGCACTGGCTCCCCTCCGCCATCTGCTGATCGCCAAACGGGGGCACCCGGAAGAATTGTTTGTCGAACTC
TCGCGGCTCTCAGGCGCGCTCTGCACCTTTTCGCTCGATTCCCACCCGCGCGACCTTCCGCTCTACGATC
ACCAAAACCTCACGGACTGTTTCACCCGGTTGGAGAGCCACATCCGCATCCACCTGGAAACCGTGCTTCC
CACCAATTGCATCGCGATCCCGCTGGAGGCGGCGGGCGACTGTTTCTACGAAGGGAAGATCACCGATCCG
CGCTGTCTGGGCAACTCCCGCTGGGTTCTCGGCATTCGCGCTGGAGTGCCCGACGCAGAGCTGATGACGC
AAGTTCCGCAACTGGTCAAAGTCTGCACCCCGGTTTTTGTGCGCGAGCTCGTCAACCGCGCCCTGCCCGG
CATGCCGCTCACCCATCTGCCCGTTCCGCCAGCGGCAATTTCCACACAAGTCGAAACGCAGTATTTCGGG
ATCAGCAGGACGGGGCCCTGCTGGAACCACATGCTCCAGACGCGACAGGTGGGGGTCTATGTTCCCAGCG
CGTTCCCCAACCCCGAACTTCAGGTACTGGTAGTGCTCGATAGCTAA
 Primer design

Protein ID: 116619369
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0227
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]306739..308094 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ02CH6
KEGG IDsus:Acid_0227
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-132, Aligned region: 19..446
Protein Sequence: 451 a.a.     [Download]
>gi|116619369|ref|YP_821525.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MKRLQPVIWTKGTFLSPQHLQMQDRFLESVLRFHLDSLSFRPWGFRTLQISREALDAGSLGISSASGIFP
DGLLFDIPGSDSAPPPKLLAECFEPDQTTLDVYLSVPQYRERGLNVATAARQGSARYRAEVELFRDENTG
LSEKPVQIARKNLRLITEGESLDGFASLRVARVRRTEAGTFQADPRFVPPLLDFHSSDYLAGIARQLVEI
LTARSGAIAGLRRQKNQSLADFTAADIANFWLLYTVNTAFPLFRHLFETRGGHPEELFSAMLSLAGSLTT
FSAKVHPRDLPAYDHDNLGGCFAELDEKLRLLLDTVVASNVVSLPLKLLKPSIYATSLDHDKYLVNTKMY
LAIGAETSQAEIVGKTPNLVKICSASHIEHLVRQALPGVPLTYVPQPPGAIPVKLNFQYFALTQTGAAWE
SIQRSRNFAAYIPGDLPNPQAELIIVLPQSS
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|116619145|ref|NC_008536.1|:c308094-306739 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGAAGCGACTGCAACCGGTGATCTGGACCAAAGGCACATTCCTGAGTCCGCAACATCTCCAGATGCAGG
ACCGTTTTCTCGAAAGCGTGCTCCGCTTTCACCTGGATAGCTTGTCGTTCCGGCCCTGGGGCTTTCGAAC
TCTGCAGATCAGCCGCGAAGCTCTGGACGCCGGCTCGCTCGGAATATCCAGCGCTTCCGGCATTTTCCCG
GATGGCCTGCTCTTCGATATCCCAGGGTCCGATTCGGCCCCACCGCCCAAGTTGCTCGCCGAGTGCTTCG
AGCCGGATCAGACTACGCTCGACGTGTACCTCTCGGTTCCTCAATACCGCGAGCGCGGCCTGAACGTAGC
GACCGCCGCGCGGCAGGGGAGTGCCCGCTACCGCGCAGAGGTCGAGCTTTTCCGCGACGAAAATACCGGT
CTCTCCGAAAAGCCCGTGCAGATCGCGCGTAAGAACCTGCGCCTGATCACCGAAGGCGAATCCCTCGACG
GCTTCGCGAGCCTCCGTGTCGCGCGAGTGCGGCGCACCGAGGCCGGAACCTTCCAGGCCGATCCGCGGTT
CGTTCCGCCCCTGCTCGATTTCCACAGCAGCGATTACCTGGCCGGCATCGCGCGTCAACTGGTGGAAATC
CTGACCGCCCGCTCGGGAGCCATCGCCGGGCTGCGCCGCCAGAAGAACCAGAGCCTCGCCGATTTCACCG
CAGCCGATATCGCCAATTTCTGGCTGCTCTACACCGTAAACACGGCTTTTCCTCTCTTCCGTCATCTGTT
CGAGACCCGTGGCGGCCACCCCGAGGAATTATTCTCGGCGATGCTCTCGCTGGCCGGTTCGCTGACCACG
TTCTCGGCCAAGGTCCACCCTCGCGACCTGCCCGCTTACGATCACGACAACCTGGGCGGCTGCTTCGCCG
AACTCGACGAAAAGCTGCGTCTGCTGCTCGACACCGTCGTCGCCAGCAACGTGGTCTCTCTGCCGCTCAA
GCTCCTCAAGCCTTCGATCTACGCCACCTCGCTGGACCACGACAAGTACCTGGTGAACACGAAGATGTAT
CTCGCCATCGGCGCCGAGACCAGTCAGGCTGAAATCGTCGGCAAGACGCCGAATCTGGTGAAGATCTGCT
CCGCCAGCCACATCGAGCACCTTGTGCGGCAGGCGCTCCCCGGCGTGCCGTTGACCTACGTGCCGCAGCC
GCCGGGCGCAATCCCCGTGAAGCTCAACTTCCAGTATTTCGCTCTCACGCAGACCGGCGCCGCCTGGGAA
TCGATCCAGCGTTCGCGCAATTTCGCGGCGTACATCCCGGGGGATCTGCCCAACCCACAGGCCGAGCTGA
TTATCGTTCTGCCGCAAAGCAGCTGA
 Primer design