SecReT6
Protein ID: 116619369
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0227
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]306739..308094 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ02CH6
KEGG IDsus:Acid_0227
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-132, Aligned region: 19..446
Protein Sequence: 451 a.a.     [Download]
>gi|116619369|ref|YP_821525.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MKRLQPVIWTKGTFLSPQHLQMQDRFLESVLRFHLDSLSFRPWGFRTLQISREALDAGSLGISSASGIFP
DGLLFDIPGSDSAPPPKLLAECFEPDQTTLDVYLSVPQYRERGLNVATAARQGSARYRAEVELFRDENTG
LSEKPVQIARKNLRLITEGESLDGFASLRVARVRRTEAGTFQADPRFVPPLLDFHSSDYLAGIARQLVEI
LTARSGAIAGLRRQKNQSLADFTAADIANFWLLYTVNTAFPLFRHLFETRGGHPEELFSAMLSLAGSLTT
FSAKVHPRDLPAYDHDNLGGCFAELDEKLRLLLDTVVASNVVSLPLKLLKPSIYATSLDHDKYLVNTKMY
LAIGAETSQAEIVGKTPNLVKICSASHIEHLVRQALPGVPLTYVPQPPGAIPVKLNFQYFALTQTGAAWE
SIQRSRNFAAYIPGDLPNPQAELIIVLPQSS
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|116619145|ref|NC_008536.1|:c308094-306739 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGAAGCGACTGCAACCGGTGATCTGGACCAAAGGCACATTCCTGAGTCCGCAACATCTCCAGATGCAGG
ACCGTTTTCTCGAAAGCGTGCTCCGCTTTCACCTGGATAGCTTGTCGTTCCGGCCCTGGGGCTTTCGAAC
TCTGCAGATCAGCCGCGAAGCTCTGGACGCCGGCTCGCTCGGAATATCCAGCGCTTCCGGCATTTTCCCG
GATGGCCTGCTCTTCGATATCCCAGGGTCCGATTCGGCCCCACCGCCCAAGTTGCTCGCCGAGTGCTTCG
AGCCGGATCAGACTACGCTCGACGTGTACCTCTCGGTTCCTCAATACCGCGAGCGCGGCCTGAACGTAGC
GACCGCCGCGCGGCAGGGGAGTGCCCGCTACCGCGCAGAGGTCGAGCTTTTCCGCGACGAAAATACCGGT
CTCTCCGAAAAGCCCGTGCAGATCGCGCGTAAGAACCTGCGCCTGATCACCGAAGGCGAATCCCTCGACG
GCTTCGCGAGCCTCCGTGTCGCGCGAGTGCGGCGCACCGAGGCCGGAACCTTCCAGGCCGATCCGCGGTT
CGTTCCGCCCCTGCTCGATTTCCACAGCAGCGATTACCTGGCCGGCATCGCGCGTCAACTGGTGGAAATC
CTGACCGCCCGCTCGGGAGCCATCGCCGGGCTGCGCCGCCAGAAGAACCAGAGCCTCGCCGATTTCACCG
CAGCCGATATCGCCAATTTCTGGCTGCTCTACACCGTAAACACGGCTTTTCCTCTCTTCCGTCATCTGTT
CGAGACCCGTGGCGGCCACCCCGAGGAATTATTCTCGGCGATGCTCTCGCTGGCCGGTTCGCTGACCACG
TTCTCGGCCAAGGTCCACCCTCGCGACCTGCCCGCTTACGATCACGACAACCTGGGCGGCTGCTTCGCCG
AACTCGACGAAAAGCTGCGTCTGCTGCTCGACACCGTCGTCGCCAGCAACGTGGTCTCTCTGCCGCTCAA
GCTCCTCAAGCCTTCGATCTACGCCACCTCGCTGGACCACGACAAGTACCTGGTGAACACGAAGATGTAT
CTCGCCATCGGCGCCGAGACCAGTCAGGCTGAAATCGTCGGCAAGACGCCGAATCTGGTGAAGATCTGCT
CCGCCAGCCACATCGAGCACCTTGTGCGGCAGGCGCTCCCCGGCGTGCCGTTGACCTACGTGCCGCAGCC
GCCGGGCGCAATCCCCGTGAAGCTCAACTTCCAGTATTTCGCTCTCACGCAGACCGGCGCCGCCTGGGAA
TCGATCCAGCGTTCGCGCAATTTCGCGGCGTACATCCCGGGGGATCTGCCCAACCCACAGGCCGAGCTGA
TTATCGTTCTGCCGCAAAGCAGCTGA
 Primer design