SecReT6
Protein ID: 116619373
SecReT6 ID153
T6SS typei4b
Gene symbol-
Locus tagAcid_0231
StrainCandidatus Solibacter usitatus Ellin6076
Repliconchromosome [GenBank: NC_008536] [Browse all T6SS(s) in this replicon]
Location [Strand]312973..313491 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ02CH2
KEGG IDsus:Acid_0231
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.80E-61, Aligned region: 10..167
Protein Sequence: 172 a.a.     [Download]
>gi|116619373|ref|YP_821529.1| unnamed protein product [Candidatus Solibacter usitatus Ellin6076]
MAKQSTQHKLDRVRSPRVQITYDVEMGGAIELKELPFVMGVMGDFTGQPTEPLARVKDRKFVDVNPDNFD
AVLESMKPHLAFSVENKLSEDPEAPKLKVDLNFKSMDDFSPDSVARQVKPLRELLELRDRLSDLRGSMQG
NDKLEELLREAVTDKDKLARLKSELGKEGSNE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|116619145|ref|NC_008536.1|:312973-313491 Candidatus Solibacter usitatus Ellin6076 chromosome, complete genome
ATGGCGAAACAGAGCACACAGCATAAACTGGACCGCGTCCGCTCTCCACGCGTGCAAATCACCTACGACG
TCGAAATGGGCGGGGCCATCGAGCTCAAGGAATTGCCTTTTGTTATGGGCGTAATGGGAGACTTCACGGG
CCAGCCGACCGAGCCGTTGGCGCGCGTGAAGGACCGAAAGTTCGTTGACGTCAACCCGGATAACTTCGAT
GCTGTCCTGGAGAGCATGAAACCGCACCTCGCCTTCTCGGTGGAGAACAAACTGAGCGAGGATCCCGAAG
CACCCAAGCTTAAAGTCGATCTCAACTTCAAGAGCATGGACGATTTTTCGCCGGACAGTGTCGCCCGGCA
AGTCAAGCCTCTGAGAGAGTTGCTGGAATTGCGAGACCGGCTATCCGATCTGCGCGGCAGCATGCAGGGC
AACGACAAACTGGAGGAGTTGCTCCGCGAGGCGGTCACCGATAAGGACAAACTGGCGCGCCTCAAGAGTG
AGCTGGGCAAGGAGGGGTCCAATGAGTAA
 Primer design